Recombinant Escherichia coli O157:H7 Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for your consideration.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Repeated freeze-thaw cycles should be avoided.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a particular tag type, please inform us, and we will prioritize its development.
Synonyms
crcB; ECH74115_0713; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-127
Protein Length
full length protein
Species
Escherichia coli O157:H7 (strain EC4115 / EHEC)
Target Names
crcB
Target Protein Sequence
MLQLLLAVFIGGGTGSVARWLLSMRFNPLHQAIPLGTLAANLIGAFIIGMGFAWFSRMTN IDPVWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVFVNLLGSFAMTALAFWL FSASTAH
Uniprot No.

Target Background

Function
Crucial for reducing intracellular fluoride concentration, thereby mitigating its toxicity.
Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the CrcB homolog in Escherichia coli O157:H7 and what is its function?

The CrcB homolog in Escherichia coli O157:H7 is a 127-amino acid transmembrane protein that functions primarily in fluoride ion efflux. It plays a critical role in bacterial fluoride resistance by expelling toxic fluoride ions from the cytoplasm. This protein is part of a conserved family of fluoride channels found across diverse bacterial species and is typically regulated by fluoride-responsive riboswitches . The sequence of the full-length protein is: MLQLLLAV FIGGGVGSVA RWLLSMRFNP LHQAIPLGTL AANLLIGAFI IGMGFAWFSR MTNIDPVWKV LITTGFCGGL TTFSTFSAEV VFLLQEGRFG WALLNVFVNL LGSFAMTALA FWLFSASTAH .

How is the CrcB homolog gene regulated in E. coli O157:H7?

The CrcB homolog gene in E. coli O157:H7 is primarily regulated by a fluoride-responsive riboswitch (formerly called the crcB RNA motif). This is a conserved RNA structure that acts as a genetic control element, increasing expression of downstream genes, including the CrcB homolog, when fluoride levels are elevated. The riboswitch undergoes conformational changes upon binding fluoride ions, which alters the accessibility of the Shine-Dalgarno sequence and subsequently affects translation initiation . This regulation mechanism allows the bacterium to respond to environmental fluoride exposure by increasing expression of fluoride resistance proteins when needed.

What experimental methods are commonly used to study CrcB homolog expression?

Several experimental approaches are used to study CrcB homolog expression:

  • RNA isolation and qRT-PCR: For quantifying crcB transcript levels under various conditions

  • Fluorescent protein fusions: Similar to techniques used with other E. coli O157:H7 proteins, where GFP or luciferase reporters can be fused to the crcB gene to visualize expression patterns

  • Microarray analysis: For genome-wide transcriptional profiling to understand crcB expression in different environmental contexts

  • Riboswitch structural analysis: Using in-line probing and X-ray crystallography to understand the mechanism of fluoride-dependent regulation

  • Western blot analysis: For detecting and quantifying CrcB protein levels using specific antibodies

What is the significance of studying CrcB homolog in pathogenic E. coli O157:H7?

Studying the CrcB homolog in pathogenic E. coli O157:H7 is significant for several reasons:

  • Antimicrobial resistance mechanisms: Understanding fluoride resistance may provide insights into bacterial survival mechanisms against antimicrobial compounds

  • Environmental adaptation: CrcB contributes to the bacterium's ability to adapt to different environments, including those with high fluoride concentrations

  • Evolutionary context: The presence of crcB in specific lineages of E. coli O157:H7 and not others may provide insights into the evolutionary history and acquisition of genetic elements

  • Potential therapeutic targets: As a membrane protein involved in ion transport, CrcB might represent a target for novel antimicrobial strategies

  • Diagnostic applications: CrcB expression patterns might serve as biomarkers for specific environmental exposures or stress responses

How should I design experiments to express and purify recombinant CrcB homolog protein?

For expression and purification of recombinant CrcB homolog from E. coli O157:H7, consider this optimized protocol:

Expression System Design:

  • Vector selection: Use a vector with an inducible promoter (e.g., pET system) and appropriate tags (His-tag or GST-tag) for purification

  • Host strain selection: Consider BL21(DE3) derivatives optimized for membrane protein expression

  • Codon optimization: Optimize codons for efficient expression in the selected host

Expression Protocol:

  • Transform expression vector into appropriate host strain

  • Culture in appropriate media (LB or 2xYT) at 37°C until OD600 reaches 0.6-0.8

  • Induce with appropriate inducer (IPTG for pET systems) at reduced temperature (16-20°C) to promote proper folding

  • Continue expression for 12-18 hours

Membrane Protein Purification Strategy:

  • Harvest cells by centrifugation (5,000 × g, 15 minutes, 4°C)

  • Resuspend in lysis buffer containing appropriate detergents (e.g., 1% DDM or 1% LDAO)

  • Lyse cells using sonication or French press

  • Centrifuge at low speed to remove cell debris, then ultracentrifuge (100,000 × g) to collect membrane fraction

  • Solubilize membrane proteins with gentle detergents

  • Purify using affinity chromatography followed by size exclusion chromatography

Quality Control:

  • Verify purity by SDS-PAGE

  • Confirm identity by Western blot and/or mass spectrometry

  • Assess functional activity through fluoride transport assays

What are the best methods for analyzing CrcB homolog interactions with fluoride ions?

To analyze CrcB homolog interactions with fluoride ions, employ these methodologies:

Direct Binding Assays:

  • Isothermal Titration Calorimetry (ITC): To determine binding affinity, stoichiometry, and thermodynamic parameters

  • Microscale Thermophoresis (MST): For measuring binding affinities in solution with minimal protein consumption

  • Surface Plasmon Resonance (SPR): To analyze real-time binding kinetics

Functional Transport Assays:

  • Fluoride-selective electrode measurements: To directly measure fluoride transport in reconstituted proteoliposomes

  • Fluorescent indicators: Using fluoride-sensitive fluorophores to monitor transport in real-time

  • Radioactive 18F-fluoride flux assays: For high-sensitivity measurement of transport activity

Structural Studies:

  • X-ray crystallography: To determine atomic-level structures with bound fluoride

  • Cryo-EM: For structural determination of the membrane protein in near-native conditions

  • NMR spectroscopy: For analyzing dynamics of fluoride binding

Computational Methods:

  • Molecular dynamics simulations: To model fluoride interactions and transport mechanisms

  • Docking studies: To predict fluoride binding sites and interaction energies

How can I establish an in vitro system to study CrcB homolog function?

To establish an effective in vitro system for studying CrcB homolog function:

Reconstitution System Options:

  • Proteoliposomes:

    • Extract lipids from E. coli or use synthetic lipids (POPC/POPE mixture)

    • Purify CrcB protein in detergent

    • Mix protein and lipids at appropriate ratios (typically 1:100 to 1:1000 protein:lipid)

    • Remove detergent using Bio-Beads or dialysis

    • Verify reconstitution by freeze-fracture electron microscopy

  • Nanodiscs:

    • Use MSP (membrane scaffold protein) to create nanodiscs containing CrcB

    • Advantages include size homogeneity and accessibility to both sides of membrane

  • Planar lipid bilayers:

    • For electrophysiological measurements of ion conductance

Functional Assays:

  • Fluoride efflux/influx measurements:

    • Load vesicles with fluoride-sensitive fluorophores

    • Monitor fluorescence changes upon initiation of transport

  • Patch-clamp electrophysiology:

    • For single-channel measurements of fluoride conductance

  • Fluoride electrode-based assays:

    • Direct measurement of fluoride concentrations

Controls and Validation:

  • Include non-functional CrcB mutants as negative controls

  • Use ionophores or detergents as positive controls for membrane permeabilization

  • Include protein-free liposomes to assess baseline leakage

How does the structure of CrcB homolog relate to its fluoride transport mechanism?

The structure-function relationship of CrcB homolog in fluoride transport involves:

Structural Features:

  • Transmembrane Domain Organization:

    • CrcB forms a dual-topology homodimer in the membrane

    • Each monomer contains 3-4 transmembrane helices creating a channel

    • The channel constriction site contains conserved positively charged residues that coordinate fluoride ions

  • Key Functional Residues:

    • Conserved arginine and lysine residues in the channel pore create a positive electrostatic environment that attracts negatively charged fluoride ions

    • Hydrophobic residues line the channel, facilitating fluoride transport

  • Structural Comparison Table:

FeatureCrcB HomologClC-F TransportersOther Ion Channels
TopologyDual-topology homodimer10-12 TM domainsVaries
Selectivity FilterBasic residues (Arg, Lys)Positively charged trackIon-specific
Transport MechanismChannel/transporter hybridH+/F- antiporterVaries by channel
Oligomeric StateHomodimerHomodimerVaries

Transport Mechanism:

  • The fluoride transport mechanism involves a combination of electrostatic attraction and hydrophobic gating

  • The positively charged residues in the channel create an energy well for fluoride ions

  • The hydrophobic gate regulates ion passage, possibly responding to membrane potential

Future structural studies using cryo-EM or X-ray crystallography of the E. coli O157:H7 CrcB homolog would provide more definitive information about its specific structural features.

What is the evolutionary relationship between CrcB homologs in pathogenic and non-pathogenic E. coli strains?

The evolutionary relationship of CrcB homologs across E. coli strains reveals important insights:

Phylogenetic Analysis:

  • Acquisition Pattern:

    • CrcB homologs were likely acquired through horizontal gene transfer, similar to many genes in E. coli O157:H7

    • The gene appears to be part of the genomic changes that occurred during the evolution from the less virulent E. coli O55:H7 to pathogenic E. coli O157:H7

  • Sequence Conservation:

    • Core functional domains of CrcB are highly conserved across pathogenic and non-pathogenic strains

    • Differences primarily occur in regulatory regions and non-essential domains

    • Key fluoride-binding residues show the highest conservation

Evolutionary Context:

  • The acquisition of CrcB may relate to environmental adaptation rather than virulence directly

  • Fluoride resistance could provide selective advantages in certain ecological niches

  • The presence of CrcB correlates with other genetic elements acquired during E. coli O157:H7 evolution, suggesting co-selection

Comparative Genomic Analysis:

  • CrcB may be part of mobile genetic elements or genomic islands

  • Its distribution pattern across E. coli strains may reflect the ecological history of different lineages

  • The gene appears to have undergone selection pressure consistent with its functional importance

How does CrcB homolog expression change under different environmental stresses in E. coli O157:H7?

CrcB homolog expression in E. coli O157:H7 responds dynamically to various environmental stresses:

Stress Response Patterns:

Environmental StressCrcB Expression ChangeAssociated Regulatory Factors
Elevated FluorideSignificant upregulationFluoride riboswitch activation
Acid StressModerate upregulationPossible co-regulation with acid resistance genes
Oxidative StressVariable responseMay depend on specific oxidative agent
Nutrient LimitationSlight downregulationGeneral stress response
Host EnvironmentContextual regulationDepends on specific host conditions
Anaerobic ConditionsPotential upregulationMay be co-regulated with anaerobic response genes

Regulatory Networks:

  • Primary Regulation: The fluoride riboswitch directly controls expression in response to fluoride levels

  • Secondary Regulation: Additional transcription factors may modulate expression under different stress conditions

  • Cross-talk: Potential interaction with other stress response systems, such as the rpoS-mediated general stress response

Experimental Evidence:

  • Transcriptomic analyses show differential expression under various growth conditions

  • The gene may be part of stress response networks that help E. coli O157:H7 adapt to changing environments

  • Expression patterns may differ between laboratory conditions and natural environments like the bovine intestinal tract

Methodological Approaches:

  • RNA-seq analysis under various stress conditions

  • Reporter gene fusions to monitor expression in real-time

  • Chromatin immunoprecipitation to identify transcription factor binding

How can CRISPR-Cas9 gene editing be applied to study CrcB homolog function in E. coli O157:H7?

CRISPR-Cas9 gene editing offers powerful approaches for studying CrcB homolog function:

CRISPR-Based Strategies:

  • Gene Knockout Studies:

    • Design sgRNAs targeting the crcB gene

    • Use CRISPR-Cas9 with λ Red recombineering for scarless gene deletion

    • Assess phenotypic changes in fluoride sensitivity, stress responses, and membrane physiology

    • Complement with wild-type or mutant crcB to confirm phenotype specificity

  • Point Mutation Generation:

    • Create specific mutations in conserved residues to determine their functional importance

    • Use base editing or prime editing for precise modifications without double-strand breaks

    • Generate a library of mutations to map the structure-function relationship

  • Regulatory Element Modification:

    • Target the fluoride riboswitch to understand its regulatory function

    • Modify promoter elements to alter expression patterns

    • Create constitutive expression constructs to assess overexpression effects

Experimental Design Considerations:

  • Control Selection:

    • Include multiple control strains (parental, vector-only, off-target guides)

    • Use multiple guide RNAs to confirm phenotype consistency

  • Phenotypic Assays:

    • Fluoride sensitivity assays at various concentrations

    • Growth curve analysis under different stress conditions

    • Membrane integrity assessments

    • Transcriptomic profiling of knockout strains

  • Delivery Methods:

    • Electroporation of ribonucleoprotein complexes

    • Plasmid-based expression of Cas9 and sgRNA

    • Consider inducible Cas9 systems to minimize toxicity

  • Validation Approaches:

    • PCR and sequencing to confirm edits

    • RT-qPCR to verify expression changes

    • Western blotting to confirm protein absence/modification

    • Whole-genome sequencing to check for off-target effects

What are the best approaches for analyzing CrcB homolog localization in E. coli O157:H7 cells?

To effectively analyze CrcB homolog localization in E. coli O157:H7 cells:

Protein Tagging Strategies:

  • Fluorescent Protein Fusions:

    • C-terminal or N-terminal GFP/mCherry fusions with careful linker design

    • Split-GFP system for minimal disruption of membrane protein topology

    • Photoactivatable or photoconvertible fluorescent proteins for super-resolution imaging

  • Epitope Tagging:

    • Small epitope tags (FLAG, HA, Myc) for immunofluorescence

    • Consider insertion into extracellular or cytoplasmic loops to preserve function

    • Validate multiple tag positions to ensure proper folding and function

Imaging Techniques:

  • Confocal Microscopy:

    • For high-resolution imaging of CrcB distribution

    • Z-stack acquisition for 3D localization analysis

  • Super-Resolution Microscopy:

    • STORM or PALM imaging for nanoscale localization

    • Structured illumination microscopy (SIM) for improved resolution

  • Electron Microscopy:

    • Immuno-gold labeling for transmission electron microscopy

    • Cryo-electron tomography for native state visualization

Fractionation and Biochemical Approaches:

  • Membrane Fractionation:

    • Separate inner and outer membranes using sucrose gradient ultracentrifugation

    • Western blot analysis of fractions with CrcB-specific antibodies

    • Compare with known inner membrane and outer membrane markers

  • Protease Accessibility Assays:

    • Determine topology using protease protection assays

    • Compare accessibility in intact cells versus spheroplasts

Validation Controls:

  • Include well-characterized membrane proteins as controls

  • Verify functionality of tagged proteins through complementation assays

  • Use multiple independent methods to confirm localization patterns

How should researchers design antibodies specific to E. coli O157:H7 CrcB homolog?

Designing highly specific antibodies against E. coli O157:H7 CrcB homolog requires careful consideration:

Epitope Selection Strategy:

  • Sequence Analysis:

    • Identify unique regions in CrcB homolog not conserved in other proteins

    • Focus on hydrophilic, surface-exposed regions (extracellular loops or cytoplasmic domains)

    • Avoid transmembrane regions which are typically poor antigens

  • Epitope Candidates:

    • N-terminal or C-terminal peptides if they are unique and accessible

    • Hydrophilic loop regions between transmembrane domains

    • Consider a multi-epitope approach targeting 2-3 regions simultaneously

Antibody Production Approaches:

  • Peptide Antibodies:

    • Synthesize peptides corresponding to selected epitopes

    • Conjugate to carrier proteins (KLH or BSA)

    • Immunize rabbits or mice using standard protocols

    • Consider using multiple peptides for broader recognition

  • Recombinant Protein Fragments:

    • Express soluble domains of CrcB (avoiding transmembrane regions)

    • Purify under native conditions if possible

    • Use for immunization and subsequent antibody purification

  • Phage Display or Synthetic Libraries:

    • For generating highly specific monoclonal antibodies

    • Allows for negative selection against homologous proteins

Validation and Purification:

  • Specificity Testing:

    • Western blot against wild-type and crcB knockout strains

    • Cross-reactivity testing against related bacterial species

    • Immunoprecipitation followed by mass spectrometry

  • Affinity Purification:

    • Use epitope-coupled affinity columns

    • Test in multiple applications (Western blot, immunofluorescence, ELISA)

  • Application-Specific Validation:

    • For immunofluorescence: verify localization pattern

    • For Western blotting: confirm band size and specificity

    • For immunoprecipitation: verify pull-down efficiency

What are the optimal conditions for studying CrcB homolog interactions with other bacterial proteins?

To effectively study CrcB homolog interactions with other bacterial proteins:

Interaction Discovery Methods:

  • Affinity Purification-Mass Spectrometry (AP-MS):

    • Express tagged CrcB homolog in E. coli O157:H7

    • Crosslink if necessary to capture transient interactions

    • Purify under gentle conditions to maintain complexes

    • Identify interacting partners by mass spectrometry

    • Validate with reverse pull-downs

  • Bacterial Two-Hybrid Systems:

    • Adapt bacterial two-hybrid systems for membrane protein analysis

    • BACTH (Bacterial Adenylate Cyclase Two-Hybrid) system is particularly suitable

    • Screen against genomic libraries or candidate partners

  • Split-Protein Complementation Assays:

    • Split-GFP or split-luciferase systems

    • Particularly useful for visualizing interactions in living cells

Membrane Protein-Specific Considerations:

  • Detergent Selection:

    • Test multiple detergents (DDM, LMNG, CHAPS) for optimal solubilization

    • Consider native nanodiscs or SMALPs to maintain lipid environment

    • Validate that detergents do not disrupt relevant interactions

  • Buffer Optimization:

    • Test range of pH conditions (typically pH 6.5-8.0)

    • Optimize salt concentration (100-300 mM NaCl typical)

    • Include stabilizing additives if necessary (glycerol, specific lipids)

Biophysical Validation Methods:

  • Microscale Thermophoresis (MST):

    • For quantitative analysis of binding affinities

    • Works well with membrane proteins in detergent

  • Biolayer Interferometry (BLI) or Surface Plasmon Resonance (SPR):

    • For kinetic analysis of interactions

    • Requires careful immobilization strategies for membrane proteins

  • FRET/BRET Assays:

    • For analyzing interactions in intact cells

    • Provides spatial information about interaction sites

Experimental Controls:

  • Include non-specific membrane proteins as negative controls

  • Use known interaction partners as positive controls when available

  • Validate with multiple orthogonal methods

How can functional genomics approaches be applied to understand the role of CrcB homolog in E. coli O157:H7 pathogenesis?

Functional genomics offers comprehensive approaches to understand CrcB homolog's role:

Transcriptomic Approaches:

  • RNA-Seq Analysis:

    • Compare wild-type and crcB deletion mutants under various conditions

    • Identify differentially expressed genes in response to fluoride stress

    • Examine transcriptional changes in different host environments

    • Analysis of co-regulated gene networks

  • Ribosome Profiling:

    • For studying translational regulation of CrcB and associated genes

    • Can reveal regulatory mechanisms beyond transcriptional control

Genomic Integration Methods:

  • Transposon Mutagenesis Screens:

    • Tn-Seq to identify genetic interactions with crcB

    • Conditional essentiality screens under fluoride stress

  • CRISPR Interference (CRISPRi):

    • For tunable repression of crcB and potential interacting genes

    • Allows study of partial loss-of-function phenotypes

Phenotypic Screening:

  • High-Throughput Phenotypic Assays:

    • Screen wild-type and crcB mutants across diverse growth conditions

    • Monitor survival under various stress conditions

    • Assess fitness in simulated host environments

  • Infection Models:

    • Gnotobiotic piglet models to assess colonization ability

    • Tissue culture adhesion and invasion assays

    • Comparison with other fluoride transport mutants

Integrative Data Analysis:

  • Network Analysis:

    • Construct protein-protein interaction networks

    • Integrate transcriptomic and phenotypic data

    • Identify key pathways connected to CrcB function

  • Comparative Analysis Across Strains:

    • Compare phenotypes in different E. coli lineages with/without CrcB

    • Correlate with evolutionary acquisition patterns

Experimental Design Table:

ApproachKey Questions AddressedTechnical Considerations
RNA-SeqGlobal transcriptional response to CrcB deletionControl for secondary effects; validate key findings by qRT-PCR
Tn-SeqGenetic interactions and conditional essentialityEnsure adequate library coverage; validate hits individually
CRISPRiDose-dependent phenotypesDesign multiple sgRNAs; confirm knockdown levels
Infection ModelsIn vivo relevance of CrcBConsider both acute and persistence models; use tagged strains for tracking

How does the CrcB homolog in E. coli O157:H7 differ from similar proteins in other pathogenic bacteria?

Comparative analysis of CrcB homologs across pathogenic bacteria reveals important differences:

Structural and Functional Comparison:

OrganismCrcB Homolog FeaturesFunctional DifferencesEvolutionary Context
E. coli O157:H7127 aa; membrane protein with multiple TM domainsFluoride efflux; possible secondary functionsRecently acquired relative to E. coli O55:H7
Pseudomonas aeruginosaSimilar core structure with extended cytoplasmic domainBroader ion selectivity reportedAncient, conserved across Pseudomonas species
Vibrio choleraeStructurally conserved but different electrostatic surfacePotentially coupled to other transport systemsAssociated with environmental persistence
Mycobacterium tuberculosisMore distantly related; additional domainsFunctions in more acidic environmentsAdapted to intracellular lifestyle
Salmonella entericaHighly similar to E. coli variantSimilar function but different regulationConserved across most Salmonella serovars

Regulatory Differences:

  • While most CrcB homologs are regulated by fluoride riboswitches, the specific riboswitch structures and sensitivities vary

  • Some species have additional regulatory elements overlaid on the core riboswitch control

  • Expression patterns differ in response to environmental stresses across species

Functional Adaptations:

  • Channel properties may be optimized for different host environments

  • Some bacterial species show coupling between CrcB and other transport systems

  • Secondary functions beyond fluoride transport may have evolved in specific lineages

Evolutionary Implications:

  • The gene appears to have been horizontally transferred multiple times

  • Sequence conservation suggests functional constraints on the core transport mechanism

  • The presence in diverse pathogenic bacteria suggests importance in different infection contexts

What can we learn from comparing wild-type and crcB knockout strains of E. coli O157:H7?

Comparative analysis of wild-type and crcB knockout strains reveals:

Phenotypic Differences:

ParameterWild-type E. coli O157:H7crcB Knockout StrainImplications
Fluoride ToleranceGrowth in up to 10-20 mM fluorideSeverely inhibited above 0.5-1 mM fluorideEssential role in fluoride detoxification
Growth KineticsNormal growth patternSlower growth under certain stress conditionsSecondary roles beyond fluoride resistance
Membrane IntegrityNormal integrityPotentially compromised under stressRole in membrane homeostasis
Gene ExpressionNormal stress responseAltered transcriptional profileRegulatory functions beyond transport
Virulence FactorsNormal expressionPotentially altered expression patternsIndirect effects on pathogenesis

Molecular Mechanism Insights:

  • Stress Response Networks:

    • CrcB deletion may activate compensatory mechanisms

    • Cross-talk with other ion transport systems

    • Potential upregulation of alternative detoxification pathways

  • Membrane Physiology:

    • Changes in membrane potential and permeability

    • Altered ion homeostasis beyond fluoride

    • Possible effects on membrane protein localization and function

Experimental Approaches:

  • Transcriptomic Comparison:

    • RNA-seq of wild-type vs. knockout under normal and stress conditions

    • Identification of compensatory mechanisms

  • Metabolomic Analysis:

    • Changes in central metabolism

    • Alterations in ion content and distribution

  • Infection Models:

    • Colonization and persistence differences

    • Host response variations

Complementation Studies:

  • Expressing wild-type CrcB should restore normal phenotype

  • Structure-function analysis using point mutants

  • Cross-species complementation to assess functional conservation

How does the expression and function of CrcB homolog vary across different E. coli O157:H7 strains?

Expression and function of CrcB homolog across E. coli O157:H7 strains shows important variations:

Strain-Specific Differences:

E. coli O157:H7 StrainCrcB Expression PatternFunctional CharacteristicsGenetic Context
EDL933Moderate basal expression; strong fluoride inductionHigh fluoride efflux efficiencyStandard genomic context
SakaiSimilar to EDL933Comparable function to EDL933Similar genomic organization
86-24Potentially higher basal expressionSimilar function but more robust under stressPossible promoter variations
EC4115Sequenced strain with annotated CrcB Well-characterized functionComplete genomic information available

Expression Variation Factors:

  • Promoter Sequence Differences:

    • Single nucleotide polymorphisms affecting transcription factor binding

    • Variations in riboswitch sensitivity to fluoride

    • Differences in regulatory elements

  • Genetic Background Effects:

    • Strain-specific transcription factors affecting expression

    • Variations in global regulators like rpoS

    • Differences in RNA processing and stability

Functional Implications:

  • Fluoride Resistance Variation:

    • Strain-specific tolerance levels

    • Different efficiency of fluoride efflux

    • Varying ability to maintain membrane potential under fluoride stress

  • Environmental Adaptation:

    • Differential responses to host environments

    • Variable stress resistance profiles

    • Potential differences in persistence under fluoride exposure

Research Applications:

  • The strain-specific variations provide natural variants for structure-function studies

  • Comparison across strains may reveal critical vs. dispensable features

  • Understanding these variations may help predict strain-specific behaviors in different environments

What emerging technologies could advance our understanding of CrcB homolog function?

Emerging technologies poised to transform CrcB homolog research include:

Advanced Structural Biology Approaches:

  • Cryo-Electron Microscopy (Cryo-EM):

    • Near-atomic resolution of membrane proteins in native-like environments

    • Analysis of conformational changes during transport

    • Visualization of protein complexes containing CrcB

  • Integrated Structural Biology:

    • Combining X-ray crystallography, cryo-EM, and NMR for comprehensive structural insights

    • Hydrogen-deuterium exchange mass spectrometry for dynamics

    • Single-molecule FRET for conformational analysis

Single-Cell Technologies:

  • Single-Cell RNA-Seq:

    • Analysis of cell-to-cell variation in CrcB expression

    • Identification of subpopulations with different expression patterns

    • Correlation with other cellular states

  • Live-Cell Imaging:

    • Super-resolution microscopy for nanoscale localization

    • Single-molecule tracking to follow CrcB dynamics

    • Correlative light and electron microscopy

Genome Engineering Advances:

  • CRISPR-Based Screening:

    • Genome-wide CRISPRi/CRISPRa screens for genetic interactions

    • Base editing for precise point mutations

    • Prime editing for complex modifications

  • In Situ Genome Engineering:

    • Direct modification in native contexts

    • Temporal control of gene expression

    • Spatially restricted modifications

Computational and Systems Biology:

  • AlphaFold2 and Related AI Tools:

    • Improved protein structure prediction

    • Modeling of protein-protein interactions

    • Prediction of ligand binding sites

  • Systems-Level Modeling:

    • Integration of multi-omics data

    • Predictive modeling of fluoride resistance networks

    • Machine learning for pattern recognition in large datasets

Experimental Systems:

  • Microfluidics and Organ-on-Chip:

    • Controlled environments for studying CrcB under dynamic conditions

    • Real-time monitoring of bacterial responses

    • Host-pathogen interaction studies

  • Synthetic Biology Approaches:

    • Designer systems to test CrcB function

    • Minimal systems for mechanistic studies

    • Engineered circuits to probe regulatory networks

What are the potential applications of understanding CrcB homolog function for developing new antimicrobial strategies?

Understanding CrcB homolog function offers several avenues for novel antimicrobial development:

Therapeutic Target Potential:

  • Direct CrcB Inhibition:

    • Small molecule inhibitors targeting the channel pore

    • Disruption of fluoride coordination sites

    • Allosteric modulators affecting channel gating

  • Fluoride-Based Antimicrobials:

    • Enhanced fluoride delivery systems targeting bacterial membranes

    • Combination therapies with CrcB inhibitors and fluoride

    • Exploitation of species-specific differences in CrcB structure

Resistance Mechanism Insights:

  • Cross-Resistance Patterns:

    • Understanding if CrcB confers resistance to other antimicrobials

    • Potential role in environmental persistence

    • Contribution to biofilm formation and resistance

  • Adaptive Responses:

    • Targeting bacterial adaptation pathways

    • Preventing compensatory resistance mechanisms

    • Disrupting stress response networks

Novel Screening Approaches:

  • High-Throughput Assays:

    • Fluoride sensitivity assays for screening compound libraries

    • Reporter systems based on CrcB expression

    • Structure-based virtual screening for inhibitors

  • Combination Therapy Design:

    • Identifying synergistic agents that enhance fluoride toxicity

    • Targeting multiple ion transport systems simultaneously

    • Disrupting bacterial ion homeostasis broadly

Translational Research Considerations:

  • Selectivity Challenges:

    • Developing compounds that target bacterial but not eukaryotic fluoride channels

    • Exploiting structural differences between homologs

    • Optimization of pharmacokinetic properties

  • Delivery Strategies:

    • Targeted delivery to infection sites

    • Membrane-penetrating formulations

    • Biofilm-penetrating technologies

How might the study of CrcB homolog contribute to our understanding of E. coli O157:H7 evolution and adaptation?

The study of CrcB homolog provides valuable insights into E. coli O157:H7 evolution:

Evolutionary Acquisition and Selection:

  • Genomic Context Analysis:

    • The crcB gene appears to have been acquired during the evolution from E. coli O55:H7 to O157:H7

    • May be part of horizontally transferred genetic elements

    • Selection pressure suggests important adaptive functions

  • Comparative Genomics Insights:

    • Presence/absence patterns across E. coli lineages

    • Sequence variation reflecting adaptation to different niches

    • Association with other acquired genes suggests co-selection

Adaptive Significance:

  • Environmental Adaptation:

    • Fluoride resistance may confer advantages in specific environments

    • Potential role in surviving certain antimicrobial compounds

    • Contribution to competitive fitness in mixed microbial communities

  • Host Interaction Factors:

    • Possible roles in colonization persistence

    • Adaptations to specific host defense mechanisms

    • Contribution to survival in different host compartments

Evolutionary Mechanisms:

  • Horizontal Gene Transfer (HGT):

    • Analysis of surrounding genomic regions for HGT signatures

    • Evidence for acquisition via phage, plasmid, or other mobile elements

    • Role in the mosaic genome structure of E. coli O157:H7

  • Selective Pressures:

    • Identification of positive selection signatures in the crcB sequence

    • Comparison with environmental fluoride exposure

    • Correlation with ecological niches of different strains

Future Research Applications:

  • CrcB as a marker for tracking evolutionary lineages

  • Understanding the stepwise acquisition of adaptive traits

  • Insights into how pathogens acquire and integrate new functions

What interdisciplinary approaches could be most effective for comprehensive investigation of CrcB homolog?

Effective interdisciplinary approaches for CrcB homolog investigation include:

Integrated Research Strategies:

  • Structural Biology + Computational Modeling:

    • Experimental structures validated by simulations

    • Molecular dynamics to explore transport mechanisms

    • Prediction of binding sites for fluoride and potential inhibitors

  • Microbiology + Biophysics:

    • Correlation of phenotypic changes with biophysical properties

    • Single-molecule studies of transport function

    • Integration of in vivo and in vitro data

  • Genomics + Evolution + Ecology:

    • Tracking gene acquisition across lineages

    • Correlation with environmental niches

    • Understanding selective pressures

Multi-Scale Approaches:

  • Molecular to Cellular:

    • Linking atomic structure to cellular function

    • Single-cell analysis of CrcB expression

    • Spatial organization within bacterial membranes

  • Cellular to Population:

    • Heterogeneity in bacterial populations

    • Bet-hedging strategies involving CrcB

    • Community interactions affected by fluoride resistance

  • Laboratory to Environmental:

    • Validation of laboratory findings in natural settings

    • Field studies of fluoride resistance

    • Ecological context of CrcB function

Methodological Integration:

  • Multi-Omics Integration:

    • Combining genomics, transcriptomics, proteomics, and metabolomics

    • Systems-level modeling of fluoride response networks

    • Machine learning approaches to identify patterns

  • Combined Imaging Modalities:

    • Correlative microscopy spanning multiple scales

    • Integration of structural and functional imaging

    • Real-time imaging with molecular specificity

Collaborative Framework:

  • Cross-Disciplinary Teams:

    • Structural biologists, microbiologists, evolutionary biologists

    • Biophysicists, computational modelers, systems biologists

    • Clinical microbiologists, environmental scientists

  • Shared Resources and Platforms:

    • Standardized strain collections

    • Common experimental protocols

    • Integrated data repositories

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.