Recombinant Escherichia coli O157:H7 Rhomboid protease glpG (glpG)

Shipped with Ice Packs
In Stock

Description

1. Definition and Biological Role

Recombinant Escherichia coli O157:H7 Rhomboid protease GlpG (glpG) is a genetically engineered intramembrane serine protease derived from the pathogenic E. coli O157:H7 strain. This enzyme belongs to the rhomboid protease family (EC 3.4.21.105), which catalyzes proteolytic cleavage of transmembrane substrates within lipid bilayers . GlpG plays critical roles in bacterial membrane protein quality control, substrate recognition, and regulated intramembrane proteolysis (RIP) . Recombinant versions are produced for biochemical and structural studies, enabling insights into bacterial pathogenesis and protease mechanisms .

3. Enzymatic Properties

Catalytic Mechanism

  • Cleaves substrates at hydrophilic regions near transmembrane domains (TMDs), targeting sequences like Ser-Asp motifs .

  • Requires no cofactors; activity is pH-dependent, optimal at neutral conditions .

Substrate Specificity

  • Preferentially cleaves orphan subunits of bacterial respiratory complexes (e.g., HybA, FdnH) that lack stabilizing partners .

  • Recognizes structural features of TMDs rather than specific consensus sequences .

4. Applications in Research

Biochemical Studies

  • Used to investigate intramembrane proteolysis mechanisms .

  • Assayed via fluorescence-based substrates or SDS-PAGE .

5.1 Role in Membrane Quality Control
GlpG selectively degrades orphan subunits of hydrogenase-2 and formate dehydrogenase complexes, preventing accumulation of non-functional proteins .

Gut Colonization Mechanism

  • Disruption of glpG reduces E. coli O157:H7 survival in murine gut models by 100-fold .

  • Polar effects on glpR (a glycerol metabolism regulator) impair fatty acid β-oxidation, critical for nutrient utilization in mucus .

5.3 Inhibitor Binding
Phosphonofluoridate inhibitors covalently bind the catalytic serine, stabilizing conformational changes in loops L1 and L5 .

7. Future Directions

  • Engineering thermostable variants for structural biology .

  • Screening small-molecule inhibitors to block E. coli O157:H7 virulence .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipment, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
glpG; ECH74115_4732; Rhomboid protease GlpG; Intramembrane serine protease
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-276
Protein Length
full length protein
Species
Escherichia coli O157:H7 (strain EC4115 / EHEC)
Target Names
glpG
Target Protein Sequence
MLMITSFANPRVAQAFVDYMATQGVILTIQQHNQSDVWLADESQAERVRAELARFLENPA DPRYLAASWQAGHTGSGLHYRRYPFFAALRERAGPVTWVMMIACVVVFIAMQILGDQEVM LWLAWPFDPALKFEFWRYFTHALMHFSLMHILFNLLWWWYLGGAVEKRLGSGKLIVITLI SALLSGYVQQKFSGPWFGGLSGVVYALMGYVWLRGERDPQSGIYLQRGLIIFALIWIVAG WFDLFGMSMANGAHIAGLAVGLAMAFVDSLNARKRK
Uniprot No.

Target Background

Function
Rhomboid-type serine protease that catalyzes intramembrane proteolysis.
Database Links
Protein Families
Peptidase S54 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Rhomboid Protease GlpG and what is its significance in E. coli O157:H7?

Rhomboid proteases, including GlpG, are membrane-integrated enzymes that hydrolyze peptide bonds specifically within transmembrane domains of protein substrates . In Escherichia coli O157:H7, an enterohemorrhagic strain responsible for hemorrhagic colitis and hemolytic uremic syndrome in humans, GlpG may play roles in membrane protein regulation that could influence virulence pathways .

E. coli O157:H7 is a major public health concern globally, with higher hospitalization and fatality rates compared to other enteric pathogens despite lower total case numbers . The study of GlpG in this context provides insights into:

  • Membrane protein processing mechanisms in pathogenic bacteria

  • Potential regulatory pathways involved in bacterial adaptation to host environments

  • Novel targets for therapeutic intervention against this important pathogen

While the specific contributions of GlpG to E. coli O157:H7 pathogenesis remain under investigation, its conservation across bacterial species suggests fundamental biological importance.

What expression systems are optimal for recombinant GlpG production?

Based on documented methodologies, the following expression system has proven effective for recombinant GlpG production:

  • Vector selection: Expression vector containing an N-terminal His6-tag for purification purposes

  • Host strain: E. coli BL21(DE3)-RP strain (Agilent Technologies)

  • Growth conditions: LB media supplemented with 100 mg/l ampicillin at 37°C until OD600nm = 0.6

  • Induction protocol: Cooling culture on ice for 20 minutes followed by addition of 0.5 mM isopropyl β-thiogalactopyranoside (IPTG)

  • Post-induction incubation: 15°C for 16 hours to promote proper folding

This approach balances protein yield with proper folding, which is particularly important for membrane proteins like GlpG. The lower temperature during the induction phase helps minimize inclusion body formation and improves the yield of correctly folded, functional protein.

What purification strategies are most effective for isolating recombinant GlpG?

Effective purification of recombinant GlpG involves multiple steps with careful attention to maintaining the integrity of this membrane protein:

  • Cell lysis: Mechanical disruption methods that efficiently break the cell membrane without denaturing proteins

  • Membrane fraction isolation: Ultracentrifugation at 50,000 g for 2 hours using an appropriate rotor (e.g., Type 45 Ti rotor, Beckman Coulter)

  • Solubilization: Treatment with 1% n-dodecyl-β-D-maltopyranoside (DDM) to extract membrane proteins

  • Affinity chromatography: Purification using Ni2+-NTA affinity chromatography to capture His-tagged GlpG

For higher purity requirements, consider additional chromatography steps such as size exclusion or ion exchange. Good Laboratory Practice (GLP) principles should be followed throughout to ensure accountability and traceability of materials .

How can researchers verify the quality and activity of purified GlpG?

Comprehensive quality assessment of purified GlpG should include:

  • Purity analysis:

    • SDS-PAGE to verify molecular weight and purity

    • Western blot with anti-His or anti-GlpG antibodies

    • Mass spectrometry for precise molecular weight verification

  • Structural integrity assessment:

    • Circular dichroism spectroscopy to verify secondary structure content

    • Thermal shift assays to assess protein stability

    • Limited proteolysis to evaluate the compactness of protein folding

  • Functional activity verification:

    • Proteolytic activity assays using validated model substrates

    • Binding assays to measure substrate interaction

All verification procedures should be documented following GLP guidelines, including detailed methodology, raw data preservation, and proper reporting of any deviations .

What are the optimal storage conditions for purified GlpG?

While the search results don't provide specific storage recommendations for GlpG, the following guidelines are based on standard practices for membrane proteins:

  • Buffer composition: 0.2% DDM, 50 mM TrisHCl, and 200 mM NaCl, pH 8.0

  • Short-term storage (1-2 weeks): 4°C with protease inhibitors

  • Medium-term storage (1-3 months): -20°C in single-use aliquots with 10-20% glycerol

  • Long-term storage (>3 months): -80°C with cryoprotectants

Activity retention should be verified periodically to ensure protein quality. Document all storage conditions and stability testing results according to GLP standards .

What site-directed mutagenesis approaches are most informative for studying GlpG structure-function relationships?

Site-directed mutagenesis provides powerful insights into GlpG structure-function relationships. Based on available methodologies:

  • Mutagenesis methodology:

    • The QuikChange Site-Directed Mutagenesis kit (Agilent Technologies) has been successfully used for GlpG modifications

    • Multiple mutagenesis strategies can be implemented (substitution, deletion, insertion)

  • Strategic mutation targets:

    • Introduction of cysteine pairs for crosslinking studies (e.g., G172C/V267C denoted as 172/267 C for C-terminal mutations)

    • Mutations in catalytic residues to assess their contributions to activity

    • Mutations at the membrane interface to study protein-lipid interactions

  • Analysis of mutants:

    • Comparison of expression levels and folding efficiency

    • Assessment of structural changes using spectroscopic methods

    • Quantification of enzymatic parameters (kcat, KM)

Table 1: Example strategies for site-directed mutagenesis of GlpG

Mutation TypeTarget ResiduesPurposeAnalysis Method
Cysteine pair introductionN-terminal (N) regionConformational studiesCrosslinking, fluorescent labeling
Cysteine pair introductionC-terminal (C) region (G172C/V267C)Conformational studiesCrosslinking, fluorescent labeling
Catalytic triad mutationsActive site residuesEnzymatic mechanismActivity assays
TM domain mutationsMembrane-spanning regionsSubstrate recognitionBinding assays, structural studies

How can researchers effectively label GlpG for structural and functional studies?

The search results provide specific methodologies for labeling GlpG with fluorescent probes:

  • Preparation of cysteine variants:

    • Purify cysteine mutants (e.g., those with N-terminal or C-terminal pairs) to ~50 μM in 0.2% DDM, 50 mM TrisHCl, 200 mM NaCl, pH 8.0

    • Reduce with 10-fold molar excess of Tris(2-carboxyethyl)phosphine-HCl (TCEP) for 1 hour at room temperature

  • Labeling reaction:

    • Add 40-fold molar excess of BtnPyr-IA (prepared in DMSO at ~20 mg/ml)

    • Incubate the mixture overnight at room temperature in the dark

  • Applications of labeled GlpG:

    • Conformational studies using fluorescence spectroscopy

    • Protein-protein interaction analysis

    • Real-time monitoring of structural changes during catalysis

These approaches allow researchers to gain insights into the dynamic behavior of GlpG that cannot be achieved through static structural methods alone.

What methods are most effective for studying GlpG-substrate interactions?

Studying GlpG-substrate interactions requires specialized approaches suitable for membrane-integrated proteases:

  • In vitro reconstitution systems:

    • Incorporation of purified GlpG into liposomes or nanodiscs

    • Addition of potential substrates in detergent-solubilized or membrane-incorporated form

    • Monitoring cleavage products by gel electrophoresis or mass spectrometry

  • Binding assays:

    • Surface plasmon resonance with immobilized GlpG

    • Microscale thermophoresis for solution-based binding measurements

    • Isothermal titration calorimetry for thermodynamic parameters

  • Computational approaches:

    • Molecular docking to predict substrate binding modes

    • Molecular dynamics simulations to study dynamic interactions

    • Bioinformatic analysis of potential substrates based on sequence patterns

These complementary approaches provide a comprehensive understanding of the molecular basis of substrate recognition and cleavage by GlpG.

How can researchers address contradictory results in GlpG studies?

When faced with contradictory experimental results, researchers should implement a systematic approach to reconciliation:

  • Methodological standardization:

    • Document detailed experimental conditions (buffer composition, temperature, detergent concentration)

    • Establish control experiments that validate assay performance

    • Verify reagent quality and consistency (including recombinant protein batches)

  • Troubleshooting strategies:

    • Conduct side-by-side comparisons using identical protocols

    • Analyze potential sources of variability (protein preparation, substrate quality)

    • Implement statistical approaches to quantify experimental reproducibility

  • Collaborative verification:

    • Exchange materials between laboratories

    • Conduct blind experiments to eliminate bias

    • Pool data for meta-analysis

Proper documentation of all reconciliation efforts according to GLP guidelines ensures scientific rigor and facilitates resolution of apparent contradictions .

What are emerging approaches for studying the role of GlpG in E. coli O157:H7 pathogenesis?

Cutting-edge approaches for investigating GlpG's role in pathogenesis include:

  • Genetic manipulation strategies:

    • CRISPR-Cas9 genome editing to create precise GlpG mutations

    • Controlled expression systems to modulate GlpG levels during infection

    • Reporter fusions to monitor GlpG expression and localization

  • Infection models:

    • Cell culture systems to study host-pathogen interactions

    • Animal models to assess virulence in vivo

    • Organoid cultures for more physiologically relevant conditions

  • -Omics approaches:

    • Proteomics to identify GlpG substrates during infection

    • Transcriptomics to determine effects of GlpG on gene expression

    • Metabolomics to assess downstream metabolic consequences

These approaches enable researchers to connect molecular mechanisms to pathophysiological outcomes, potentially revealing new therapeutic targets for addressing E. coli O157:H7 infections, which remain a significant public health concern with high hospitalization and fatality rates .

What GLP considerations are important for GlpG research?

Good Laboratory Practice (GLP) principles are crucial for ensuring the quality and reproducibility of GlpG research:

  • Test item accountability:

    • Maintain traceability for all materials used in GlpG studies

    • Document the preparation and use of test substances

    • Ensure accountability for test and reference items

  • Study documentation:

    • Develop comprehensive study plans before initiation

    • Document all deviations from established protocols

    • Prepare detailed final reports with adequate compliance statements

  • Method validation:

    • Validate analytical methods before application in GLP studies

    • Document threshold, linearity, accuracy, precision, and equipment settings

    • Retain validation data for appropriate periods to enable study reconstruction

Adherence to these principles enhances data quality and facilitates regulatory acceptance of research findings.

How should researchers manage and report unexpected findings in GlpG studies?

When encountering unexpected results in GlpG research:

  • Documentation requirements:

    • Record all observations in detail, including experimental conditions

    • Document deviations from expected outcomes

    • Maintain raw data integrity for future analysis

  • Reporting procedures:

    • Include all unexpected findings in the final report

    • Issue amendments to reports if discoveries are made after study completion

    • Assess the impact of unexpected findings on study validity

  • Follow-up investigations:

    • Design targeted experiments to explore unexpected results

    • Consider alternative hypotheses that might explain observations

    • Conduct literature reviews to identify similar phenomena

This systematic approach transforms unexpected findings from potential problems into valuable research opportunities.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.