Recombinant Escherichia coli O157:H7 Spermidine export protein MdtI (mdtI)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mdtI; ECH74115_2309; Spermidine export protein MdtI
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-109
Protein Length
full length protein
Species
Escherichia coli O157:H7 (strain EC4115 / EHEC)
Target Names
mdtI
Target Protein Sequence
MAQFEWVHAAWLALAIVLEIVANVFLKFSDGFRRKIFGLLSLAAVLAAFSALSQAVKGID LSVAYALWGGFGIAATLAAGWILFGQRLNRKGWIGLVLLLAGMIMVKLA
Uniprot No.

Target Background

Function
Catalyzes spermidine excretion.
Database Links
Protein Families
Small multidrug resistance (SMR) protein family, MdtI subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the MdtI protein and what is its primary function in E. coli O157:H7?

MdtI is a membrane protein belonging to the small multidrug resistance (SMR) family of drug exporters. Its primary function, when complexed with MdtJ, is to catalyze the excretion of spermidine from E. coli cells at neutral pH . This function is particularly important for maintaining polyamine homeostasis within bacterial cells. The protein is part of a system that protects cells from the toxicity associated with spermidine overaccumulation, which can occur under various physiological conditions .

What is the relationship between MdtI and MdtJ in forming a functional spermidine export system?

MdtI and MdtJ function together as a heterodimeric complex (MdtJI) that is necessary for spermidine export. Experimental evidence demonstrates that both proteins are required for this function, as transformation with either gene alone does not rescue cell viability during spermidine overaccumulation . When E. coli CAG2242 cells (deficient in spermidine acetyltransferase) were transformed with both mdtJ and mdtI genes, cell viability during culture with 2 mM spermidine increased more than 1,000-fold compared to control cells . This indicates that the two proteins form an obligate functional complex for spermidine excretion.

How does spermidine excretion via MdtJI contribute to cellular homeostasis?

The MdtJI complex provides E. coli with a mechanism to maintain polyamine homeostasis by excreting excess spermidine. In cells expressing MdtJI, the intracellular spermidine content was significantly decreased when cultured in the presence of 2 mM spermidine, and excretion of spermidine from cells was enhanced . This homeostatic mechanism is particularly important in strains deficient in spermidine acetyltransferase, which normally metabolizes spermidine. The ability to excrete excess spermidine helps prevent the cytotoxic effects of polyamine overaccumulation, allowing cells to maintain normal growth and viability even in environments with high spermidine concentrations .

What key amino acid residues in MdtI are critical for spermidine export function?

Research has identified several key amino acid residues in MdtI that are crucial for its spermidine export function:

ProteinCritical Amino Acid Residues
MdtIGlu 5, Glu 19, Asp 60, Trp 68, Trp 81
MdtJTyr 4, Trp 5, Glu 15, Tyr 45, Tyr 61, Glu 82

These residues are directly involved in the excretion activity of the MdtJI complex . The presence of multiple acidic residues (Glu, Asp) suggests their importance in interacting with the positively charged spermidine molecule. The aromatic residues (Trp) likely play a role in the structural integrity of the transport channel or in substrate recognition. Site-directed mutagenesis of these residues significantly affects the spermidine excretion capability of the MdtJI complex, confirming their functional importance .

How can we experimentally demonstrate the spermidine export activity of the MdtJI complex?

Several experimental approaches have been validated to demonstrate the spermidine export activity of the MdtJI complex:

  • Cell Viability Assays: Using E. coli strains deficient in spermidine acetyltransferase (e.g., E. coli CAG2242), researchers can test the recovery of cell viability in the presence of toxic levels of spermidine (2-12 mM) after transformation with mdtJI genes .

  • Growth Inhibition Recovery: Measuring the growth of E. coli in the presence of high spermidine concentrations (12 mM) with and without mdtJI expression. Cells expressing MdtJI show significantly better growth compared to those without MdtJI .

  • Direct Measurement of Intracellular Polyamine Content: Quantifying the intracellular spermidine levels in cells cultured with exogenous spermidine. Cells expressing MdtJI show decreased intracellular spermidine accumulation .

  • Radioactive Spermidine Excretion Assays: Using [14C]spermidine to directly measure excretion from cells. Cells transformed with pUC mdtJI showed significant excretion of accumulated [14C]spermidine compared to control cells with empty vector .

  • Extracellular Polyamine Analysis: Measuring spermidine levels in the culture medium after removing cells by centrifugation. The level of spermidine in the medium increases significantly when cells express MdtJI .

How does the expression of mdtJI change in response to spermidine levels?

Research indicates that spermidine regulates mdtJI expression at the transcriptional level. The level of mdtJI mRNA was shown to increase in response to spermidine exposure . This suggests the presence of a feedback mechanism where elevated spermidine levels stimulate the expression of its own export system. This autoregulatory feature is likely important for maintaining polyamine homeostasis, allowing cells to respond dynamically to changing spermidine concentrations in the environment. The specific transcriptional regulators involved in this process have not been fully elucidated based on the available search results.

What techniques can be used to study the structure-function relationship of MdtI?

Several methodological approaches can be employed to investigate the structure-function relationship of MdtI:

  • Site-Directed Mutagenesis: Target specific amino acid residues (such as Glu 5, Glu 19, Asp 60, Trp 68, and Trp 81) to determine their roles in spermidine transport activity .

  • Protein Expression Systems: Use of expression vectors like pUC or pMW to produce recombinant MdtI and MdtJ proteins in E. coli hosts for functional studies .

  • Cell Competition Assays: Compare the growth and survival of wild-type and mutant strains in mixed cultures to evaluate the fitness contribution of MdtI under different conditions .

  • Protein-Protein Interaction Studies: Investigate how MdtI and MdtJ interact to form a functional complex using techniques such as co-immunoprecipitation or yeast two-hybrid assays.

  • 2D Electrophoresis and Mass Spectrometry: These techniques can be used to study differential protein expression patterns between wild-type and mdtI-deficient strains, providing insights into the broader cellular impact of MdtI function .

How can polyamine levels be accurately measured when studying MdtI function?

Accurate measurement of polyamine levels is crucial when investigating MdtI function. Established methodologies include:

  • Radioisotope Labeling: Using [14C]spermidine to track spermidine movement across cell membranes. This approach allows quantitative assessment of spermidine excretion rates .

  • HPLC Analysis: High-performance liquid chromatography can be used to separate and quantify polyamines from cell extracts and culture supernatants.

  • Intracellular Content Analysis: Extraction and quantification of polyamines from cell pellets to determine changes in intracellular polyamine pools in response to genetic manipulations or environmental conditions .

  • Extracellular Content Analysis: Measuring polyamine levels in the culture medium after removing cells by centrifugation to directly quantify excretion .

These methods can be applied to compare polyamine levels between wild-type E. coli O157:H7 and strains with modifications in mdtI expression.

How does MdtI compare to other polyamine transport systems in bacteria?

MdtI represents a distinct type of polyamine transport system compared to previously characterized transporters:

Transport SystemFunctionpH DependencySubstrate Specificity
MdtJISpermidine excretionActive at neutral pHPrimarily spermidine
PotEPutrescine uptake/excretionExcretion at acidic pH, uptake at neutral pHPutrescine
CadBCadaverine uptake/excretionExcretion at acidic pH, uptake at neutral pHCadaverine

Unlike PotE and CadB, which function as bidirectional transporters depending on pH, the MdtJI complex appears to primarily catalyze spermidine excretion at neutral pH . This distinction makes MdtJI particularly important for maintaining polyamine homeostasis under normal physiological conditions, whereas PotE and CadB may have more specialized roles in acid stress responses. Additionally, MdtJI belongs to the small multidrug resistance (SMR) family of transporters, which suggests it may have evolved from a broader substrate transporter to a more specialized polyamine exporter .

What is the relationship between MdtI and bacterial antibiotic resistance mechanisms?

E. coli O157:H7 harbors multiple mechanisms of antimicrobial resistance, including various resistance genes and integrons . While MdtI itself may not directly export antibiotics, the regulation and expression of transport systems like MdtI may be interconnected with broader stress response mechanisms that influence antibiotic susceptibility. For example, altered membrane properties due to changes in polyamine levels could potentially affect cell permeability to antibiotics.

Research on antibiotic resistance in E. coli isolates has identified multiple resistance genes including blaTEM, qnrB, and Sul1/2/3 , but direct links between these resistance mechanisms and MdtI function have not been firmly established based on the available search results.

What role might MdtI play in the virulence or survival of E. coli O157:H7?

The role of MdtI in E. coli O157:H7 virulence and survival can be considered in the context of broader stress response mechanisms:

  • Acid Resistance: E. coli O157:H7 employs multiple acid resistance (AR) systems to survive acidic environments encountered during passage through the host gastrointestinal tract . While MdtI is not directly part of the characterized AR systems (which include RpoS-dependent, arginine-dependent, and glutamate-dependent mechanisms), polyamine homeostasis maintained by MdtI could potentially influence membrane integrity and acid resistance.

  • Environmental Persistence: The ability to maintain polyamine homeostasis through systems like MdtI may contribute to bacterial survival in various environmental conditions. E. coli O157:H7 strains show differential protein expression related to survival in bovine gastrointestinal tracts and environmental persistence .

  • Host Colonization: Studies with pO157 plasmid deletion mutants have shown differences in colonization patterns in cattle . Whether MdtI impacts colonization by influencing polyamine levels during host adaptation remains an open research question.

How can understanding MdtI function contribute to novel antimicrobial strategies?

Understanding the molecular mechanisms of MdtI function could lead to several potential antimicrobial strategies:

  • Export Inhibitors: Development of specific inhibitors targeting the MdtJI complex could potentially disrupt polyamine homeostasis, leading to toxic accumulation of spermidine within bacterial cells .

  • Polyamine Metabolism Modulation: Combination strategies targeting both polyamine synthesis (e.g., speD and speE genes) and export (MdtJI) could create synergistic antimicrobial effects .

  • Structural Targets: The identified critical amino acid residues in MdtI (Glu 5, Glu 19, Asp 60, Trp 68, and Trp 81) provide specific structural targets for designing selective inhibitors .

  • Bioengineering Applications: Knowledge of MdtI function could be applied to engineer probiotics with enhanced polyamine export capabilities. For example, E. coli Nissle 1917 has been metabolically engineered to increase spermidine production by enhancing the expression of speD and speE genes . Similar approaches could be used to modulate MdtI expression in beneficial bacterial strains.

What are the key unanswered questions regarding MdtI function and regulation?

Several critical questions remain unanswered regarding MdtI function and regulation:

  • Structural Characterization: Detailed structural studies of the MdtJI complex to understand the molecular mechanism of spermidine recognition and transport.

  • Regulatory Networks: Comprehensive mapping of the transcriptional and post-transcriptional regulatory networks controlling mdtJI expression in response to various environmental conditions.

  • Substrate Specificity: Determination of the full range of substrates that can be transported by the MdtJI complex, including other polyamines or related compounds.

  • Physiological Relevance: Clarification of the physiological importance of MdtI-mediated spermidine export in various ecological niches occupied by E. coli O157:H7.

  • Evolutionary History: Tracing the evolutionary origin of MdtI as a specialized polyamine exporter within the broader SMR family of transporters.

What methodological advances would facilitate deeper understanding of MdtI function?

Several methodological advances could significantly enhance our understanding of MdtI function:

  • Real-time Transport Assays: Development of fluorescent spermidine analogs or biosensors that would allow real-time visualization of polyamine transport across bacterial membranes.

  • Cryo-EM Studies: Application of high-resolution cryo-electron microscopy to elucidate the three-dimensional structure of the MdtJI complex in different conformational states during the transport cycle.

  • Single-Cell Analysis: Implementation of single-cell techniques to investigate cell-to-cell variability in MdtI expression and function within bacterial populations.

  • Systems Biology Approaches: Integration of transcriptomics, proteomics, and metabolomics data to place MdtI function within the broader context of cellular physiology and stress responses.

  • In vivo Infection Models: Development of refined animal models to study the role of MdtI in host colonization and pathogenesis under physiologically relevant conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.