Recombinant Escherichia coli O157:H7 Spermidine export protein MdtJ (mdtJ)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
mdtJ; ECH74115_2310; Spermidine export protein MdtJ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-121
Protein Length
full length protein
Species
Escherichia coli O157:H7 (strain EC4115 / EHEC)
Target Names
mdtJ
Target Protein Sequence
MYIYWILLGLAIATEITGTLSMKWASVSEGNGGFILMLVMISLSYIFLSFAVKKIALGVA YALWEGIGILFITLFSVLLFDESLSLMKIAGLTTLVAGIVLIKSGTRKARKPELEVNHGA V
Uniprot No.

Target Background

Function

Function: Catalyzes the excretion of spermidine.

Database Links
Protein Families
Small multidrug resistance (SMR) protein family, MdtJ subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the MdtJ protein and does it function independently?

MdtJ is a membrane protein belonging to the small multidrug resistance (SMR) family of drug exporters in E. coli. Importantly, MdtJ does not function independently but forms a complex with MdtI (MdtJI complex) to facilitate spermidine excretion. Experimental evidence shows that transformation with either mdtJ or mdtI alone does not rescue E. coli cells from spermidine toxicity, indicating both proteins are required for functional spermidine export activity . The complex functions at neutral pH, unlike other polyamine transporters such as PotE and CadB which primarily function at acidic pH conditions.

Which specific amino acid residues are critical for MdtJ function?

Research has identified several key amino acid residues in MdtJ that are crucial for its spermidine export activity. Specifically, Tyr 4, Trp 5, Glu 15, Tyr 45, Tyr 61, and Glu 82 in MdtJ are directly involved in excretion activity . These residues likely contribute to substrate recognition, binding, or the conformational changes necessary for spermidine transport. Additionally, complementary residues in MdtI (Glu 5, Glu 19, Asp 60, Trp 68, and Trp 81) are equally important for the function of the complex, suggesting a cooperative mechanism of action between the two proteins.

How is mdtJ expression regulated in response to cellular conditions?

The mdtJ gene expression is specifically upregulated in response to elevated spermidine levels. Dot blot analysis of RNA samples from E. coli demonstrates that mdtJI mRNA levels increase significantly when cells are exposed to high spermidine concentrations . This regulation mechanism represents a feedback response that helps cells maintain polyamine homeostasis by increasing export capacity when intracellular spermidine levels become excessive. Additionally, in E. coli O157:H7, mdtJ may be part of multiple stress response networks, as this pathogen activates various stress regulons including CpxRA, σH, and σS when exposed to environmental stresses such as low pH and high osmolarity .

What are effective approaches for measuring MdtJ-mediated spermidine export?

Researchers can measure MdtJ-mediated spermidine export using both direct and indirect methods:

  • Cell viability assays: Using spermidine acetyltransferase-deficient strains (e.g., E. coli CAG2242) cultured with excess spermidine (2-12 mM). Cell viability recovery upon transformation with mdtJI indicates functional export activity .

  • Radioisotope tracking: Preloading cells with [14C]spermidine (37 MBq/mmol) followed by monitoring excretion into the medium over time. The method involves:

    • Preloading cells with radiolabeled spermidine for 90 minutes

    • Washing cells to remove external spermidine

    • Incubating in fresh buffer at 37°C

    • Measuring radioactivity in the supernatant after cell removal by centrifugation

  • Intracellular polyamine quantification: Measuring polyamine content in cells using HPLC or other analytical methods before and after expression of mdtJI.

The table below shows typical results from intracellular polyamine measurements:

Culture Time (h)Spermidine AdditionPutrescine (mM)Spermidine (mM)
24-3.40 ± 1.264.71 ± 1.06
24+0.24 ± 0.1012.1 ± 2.06
36-3.92 ± 0.462.83 ± 1.00
36+0.33 ± 0.2615.5 ± 1.34

Note: Values represent means ± SD for three samples, calculated based on 5 μl cell volume per mg protein .

How can researchers generate and validate mdtJ knockout mutants?

Generation of mdtJ knockout mutants can be accomplished using the lambda red recombinase procedure as demonstrated for other genes in E. coli O157:H7. The methodology involves:

  • Plasmid introduction: Transform E. coli O157:H7 with a plasmid containing IPTG-inducible lambda red recombinase (e.g., pKM208) using electroporation .

  • PCR-mediated knockout: Generate a PCR product containing a kanamycin resistance cassette flanked by homology sequences targeting mdtJ. The primers should be designed with approximately 50 bp homology to regions flanking mdtJ .

  • Recombination: Transform the PCR product into the strain carrying the recombinase plasmid. Select for kanamycin-resistant colonies .

  • Cassette removal: Remove the kanamycin cassette using FLP recombinase encoded on a plasmid such as pCP20, leaving an in-frame deletion .

  • Validation: Confirm the deletion by sequencing and functional analysis, such as measuring sensitivity to spermidine toxicity.

For MdtJ specifically, validation can be performed by testing the knockout strain's increased sensitivity to spermidine compared to the wild-type strain, followed by complementation studies to confirm phenotype restoration.

What expression systems are optimal for recombinant production of MdtJ?

For recombinant production of MdtJ, several expression systems have proven effective, each with specific advantages:

  • High-copy plasmids (pUC-based): The pUC mdtJI system provides high-level expression under the lacUV5 promoter, which is advantageous for biochemical characterization and functional studies. When both MdtJ and MdtI are co-expressed using pUC mdtJI, significant protection against spermidine toxicity is observed .

  • Low-copy plasmids (pMW-based): The pMW mdtJI system offers moderate expression levels, which may be preferable when high-level expression causes toxicity. While providing less protection than high-copy systems, pMW mdtJI still significantly rescues growth in the presence of high spermidine concentrations (12 mM) .

  • Tagged protein systems: Adding tags such as hemagglutinin (HA) or His-tags facilitates protein detection via Western blotting and protein purification. These systems are particularly useful for studying protein-protein interactions between MdtJ and MdtI.

The choice of expression system should be guided by the specific research objectives. For functional studies, co-expression of both MdtJ and MdtI is essential, as neither protein alone provides spermidine export activity.

How does MdtJ contribute to stress tolerance in E. coli O157:H7?

The MdtJ protein, as part of the MdtJI complex, plays a significant role in stress tolerance in E. coli O157:H7 by regulating polyamine homeostasis under stress conditions. While direct evidence specifically for O157:H7 is limited in the provided search results, research suggests several mechanisms:

  • Polyamine toxicity protection: By exporting excess spermidine, MdtJI prevents the cytotoxic effects of polyamine accumulation. This is particularly important under stress conditions that may alter polyamine metabolism .

  • Integration with stress response networks: In E. coli O157:H7, exposure to environmental stresses activates multiple stress response regulons, including CpxRA, σH, and σS . The MdtJI complex may function as part of these broader stress response networks.

  • Acid stress tolerance: E. coli O157:H7 induces multiple acid stress response genes when exposed to acidic conditions like those in apple juice (pH 3.5) . Since polyamines can buffer intracellular pH, regulated export of spermidine via MdtJI may contribute to pH homeostasis under acidic stress.

What is the relationship between MdtJ function and virulence in E. coli O157:H7?

The relationship between MdtJ function and virulence in E. coli O157:H7 involves several potential mechanisms:

  • Stress adaptation during infection: E. coli O157:H7 must adapt to various stresses during infection, including acid stress in the stomach and oxidative stress from host immune responses. MdtJ-mediated spermidine export may contribute to this adaptation .

  • Polyamine regulation and virulence gene expression: Polyamines can influence the expression of virulence genes. Research on E. coli O157:H7 transcriptional responses shows that when exposed to stress, this pathogen induces both stress response genes and O157-specific genes, including those encoding type three secretion effectors (espJ, espB, espM2, espL3, and espZ) . Proper polyamine homeostasis, regulated in part by MdtJ, may be necessary for optimal expression of these virulence factors.

  • Host colonization: E. coli O157:H7 colonization of the intestine involves complex host-pathogen-microbiota interactions . Polyamine homeostasis may influence bacterial adhesion, biofilm formation, and competitive fitness in the gut environment.

Additional research is needed to directly link MdtJ function to specific virulence mechanisms in E. coli O157:H7, which would involve constructing mdtJ knockout mutants and testing their virulence in appropriate animal models.

How does the MdtJI complex protect against polyamine toxicity?

The MdtJI complex protects E. coli cells from polyamine toxicity through an efficient export mechanism that prevents intracellular accumulation of excess spermidine. Experimental evidence shows:

  • Enhanced survival: E. coli CAG2242 (spermidine acetyltransferase-deficient) transformed with pUC mdtJI shows >1,000-fold increased viability when cultured with 2 mM spermidine compared to control cells .

  • Reduced intracellular spermidine: Cells expressing the MdtJI complex maintain significantly lower intracellular spermidine levels when cultured in high-spermidine medium. For example, after 24 hours in 2 mM spermidine, control cells contained 12.1 ± 2.06 mM spermidine, while cells expressing MdtJI contained only 4.71 ± 1.06 mM .

  • Active export mechanism: Direct measurement of [14C]spermidine export shows that cells expressing MdtJI actively transport spermidine out of the cell, with significant increases in extracellular spermidine over time compared to control cells .

The protective mechanism is specific to the MdtJI complex, as neither protein alone provides protection, and other drug transporters (32 others tested) do not confer significant resistance to spermidine toxicity .

How do environmental stresses affect mdtJ expression and function?

Environmental stresses significantly impact mdtJ expression and function through complex regulatory networks:

  • Spermidine-induced expression: Research demonstrates that mdtJI mRNA levels increase in response to elevated spermidine, suggesting a direct regulatory mechanism linking substrate availability to transporter expression .

  • Integration with stress response networks: In E. coli O157:H7, multiple stress response regulons activate simultaneously under environmental stress. For example, exposure to acidic, high-osmolarity environments (such as apple juice) activates CpxRA, σH, and σS regulons . Investigation of how these regulons might control mdtJ expression represents an important research direction.

  • Environmental sensing: The CpxRA system, which responds to cell envelope stress, activates genes including cpxP, degP, and htpX with 2- to 15-fold induction upon acid stress . Given that deletion of CpxRA decreases survival of O157:H7 in acidic conditions, and that MdtJ is a membrane protein, exploring the relationship between the Cpx system and mdtJ regulation would be valuable.

Future research should employ techniques such as:

  • Reporter gene assays to identify promoter elements responding to different stresses

  • ChIP-seq to identify transcription factors binding to the mdtJI promoter

  • RNA-seq to analyze differential expression under various stress conditions

  • Protein activity assays to determine how stress affects MdtJ transport function

What is the three-dimensional structure of MdtJ and how does it influence function?

The three-dimensional structure of MdtJ has not been fully characterized, representing a significant knowledge gap. Based on its classification in the small multidrug resistance (SMR) family, several structural predictions can be made:

  • Membrane topology: MdtJ likely contains 4 transmembrane helices, typical of SMR family proteins.

  • Functional residues: Mutational analysis has identified six critical residues in MdtJ (Tyr 4, Trp 5, Glu 15, Tyr 45, Tyr 61, and Glu 82) essential for function . These residues may form part of the substrate binding pocket or participate in conformational changes during transport.

  • Protein-protein interaction: The requirement for both MdtJ and MdtI suggests a specific interaction interface between these proteins, forming a heterodimeric or hetero-oligomeric complex.

Future research directions should include:

  • X-ray crystallography or cryo-EM studies of the purified MdtJI complex

  • Molecular dynamics simulations to understand spermidine binding and transport

  • Systematic alanine scanning mutagenesis to identify additional functional residues

  • Cross-linking studies to determine the stoichiometry and arrangement of MdtJ and MdtI in the complex

What animal models are most appropriate for studying MdtJ function in vivo?

Selecting appropriate animal models for studying MdtJ function in E. coli O157:H7 requires consideration of several factors:

When designing animal studies for MdtJ research, investigators should consider:

  • The specific research question (colonization, virulence, stress response)

  • The relevance of the model to human or ruminant physiology

  • The feasibility of genetic manipulation and sampling

  • Ethical considerations and regulatory requirements

How can researchers optimize recombinant MdtJ production for functional studies?

Optimizing recombinant MdtJ production requires addressing several challenges specific to membrane proteins:

  • Expression system selection: The choice between pUC-based (high-copy) and pMW-based (low-copy) vectors should be guided by the research objectives. For biochemical characterization, pUC systems provide higher protein yields, while pMW systems may reduce toxicity issues .

  • Co-expression strategy: Since MdtJ requires MdtI for function, co-expression of both proteins is essential. This can be achieved through:

    • Bicistronic constructs maintaining the natural operon structure

    • Dual-plasmid systems with compatible origins of replication

    • Fusion proteins with appropriate linkers (though this may affect function)

  • Protein tagging: Strategic placement of affinity tags (His, HA) facilitates purification and detection. Western blotting with anti-HA or anti-six-His antibodies can confirm expression levels .

  • Membrane extraction protocols: Optimized protocols for membrane protein extraction are critical:

    • Cell lysis under gentle conditions

    • Solubilization with appropriate detergents

    • Purification under conditions that maintain the MdtJ-MdtI interaction

  • Functional validation: Activity assays using [14C]spermidine export or growth rescue in spermidine-sensitive strains should be performed to confirm that the recombinant protein is functionally active .

What strategies can address challenges in studying MdtJ-MdtI protein interactions?

Studying the interaction between MdtJ and MdtI presents several technical challenges that can be addressed through these methodological approaches:

  • Co-immunoprecipitation (Co-IP): Using differentially tagged versions of MdtJ and MdtI (e.g., HA-tagged MdtJ and His-tagged MdtI) allows for sequential purification to confirm complex formation. Western blotting with specific antibodies can verify the presence of both proteins in the complex .

  • Bacterial two-hybrid systems: Modified for membrane proteins, these systems can detect protein-protein interactions in a cellular context. Split-ubiquitin or BACTH (Bacterial Adenylate Cyclase Two-Hybrid) systems are particularly suitable for membrane protein interactions.

  • FRET (Förster Resonance Energy Transfer): Fusion of fluorescent proteins to MdtJ and MdtI can enable real-time visualization of their interaction in living cells. This technique requires careful design to ensure the fluorescent tags do not disrupt membrane localization or function.

  • Cross-linking combined with mass spectrometry: Chemical cross-linking followed by mass spectrometry analysis can identify specific residues involved in the MdtJ-MdtI interaction, providing structural insights into the complex.

  • Complementation assays with chimeric proteins: Creation of chimeric proteins combining domains from MdtJ and related transporters can help identify regions essential for specific MdtJ-MdtI interactions and spermidine transport function.

These approaches should be combined with functional assays to correlate structural findings with transport activity, ultimately providing a comprehensive understanding of how the MdtJ-MdtI complex mediates spermidine export.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.