Housekeeping role: The lack of sequence diversity in yebN among strains indicates it may contribute to core cellular processes, such as membrane stability or metabolic regulation .
Co-occurrence with virulence islands: YebN resides near genomic regions associated with pathogenicity, including tellurite resistance and adherence-conferring islands .
While recombinant YebN has not been explicitly studied, insights from related membrane proteins in E. coli O157:H7 highlight challenges in recombinant protein production:
Functional characterization: No studies directly link YebN to adhesion, toxin secretion, or host interaction.
Structural studies: Predicted membrane topology models (e.g., via OPM or UniTmp databases) remain unvalidated .
Recombinant applications: Potential utility in diagnostics or vaccines requires expression optimization and antigenicity testing.
KEGG: ecf:ECH74115_2553
YebN is a membrane protein belonging to the UPF0059 family found in Escherichia coli O157:H7, a major enterohemorrhagic E. coli (EHEC) serotype associated with serious clinical manifestations including bloody diarrhea, hemorrhagic colitis (HC), and hemolytic uremic syndrome (HUS). The protein consists of 188 amino acids with a molecular structure adapted for membrane integration, as evidenced by its hydrophobic regions and transmembrane domains . E. coli O157:H7 represents a significant public health concern due to its capability to cause severe infections with potentially fatal outcomes and is associated with substantial economic burden worldwide . YebN is of particular interest to researchers because of its potential role in bacterial membrane integrity and function, which could be exploited for vaccine development or therapeutic targeting.
The complete amino acid sequence of yebN from E. coli O157:H7 (strain EC4115/EHEC) is:
MNITATVLLAFGMSMDAFAASIGKGATLHKPKFSEALRTGLIFGAVETLTPLIGWGMGMLASRFVLEWNHWIAFVLLIFLGGRMIIEGFRGADDEDEEPRRRHGFWLLVTTAIATSLDA MAVGVGLAFLQVNIIATALAIGCATLIMSTLGMMVGRFIGSIIGKKAEILGGLVLIGIGVQILWTHFHG
This 188-amino acid protein (UniProt accession: B5YQW3) displays characteristics typical of integral membrane proteins, including multiple hydrophobic regions that likely form transmembrane domains. The protein has alternating hydrophobic and hydrophilic segments, consistent with its predicted role spanning the bacterial membrane . The structure includes several conserved motifs characteristic of the UPF0059 protein family, which are preserved across various bacterial species. When expressed recombinantly, the protein is typically fused to tags (such as His-tag) at either the N-terminus or C-terminus to facilitate purification and detection in experimental settings .
Recombinant yebN protein from E. coli O157:H7 can be efficiently expressed using prokaryotic expression systems, particularly using E. coli as the host organism. The typical methodology involves:
Gene synthesis or PCR amplification of the yebN gene from E. coli O157:H7 genomic DNA
Cloning into a suitable expression vector (e.g., pET-24a(+)) with an affinity tag (commonly His-tag)
Transformation into an expression host strain such as E. coli BL21(DE3)
Expression induction using IPTG (typically 1mM) at optimal temperature and time conditions
Cell lysis and protein extraction under conditions appropriate for membrane proteins
Purification using affinity chromatography, typically nickel affinity chromatography for His-tagged proteins
For membrane proteins like yebN, purification often requires denaturing conditions due to their hydrophobic nature. The protein can be expressed with yields of approximately 1-2 mg/mL after purification, similar to other recombinant membrane proteins from E. coli . Following purification, SDS-PAGE and western blotting should be performed to confirm protein identity and purity, with expected molecular weight of approximately 20-22 kDa for the native protein, which increases when fusion tags are added .
Optimal conditions for heterologous expression of recombinant yebN involve several critical parameters that must be adjusted to maximize protein yield while maintaining proper folding:
Temperature: While standard expression protocols often use 37°C, membrane proteins like yebN may benefit from lower temperatures (18-30°C) to slow down protein production and facilitate proper folding. Expression at 37°C for 24 hours post-IPTG induction has been shown to be effective for similar membrane proteins .
Induction conditions: IPTG concentration of 1mM is typically used, with induction initiated when cultures reach mid-logarithmic phase (OD600 of 0.6-0.8).
Expression vector: pET-based vectors with T7 promoter systems (e.g., pET-24a(+)) provide strong, controllable expression. The placement of affinity tags (N-terminal versus C-terminal) should be evaluated experimentally to determine optimal folding and activity .
Host strain: E. coli BL21(DE3) is commonly used for recombinant protein expression due to its lack of certain proteases and compatibility with T7 expression systems. For membrane proteins, specialized strains like C41(DE3) or C43(DE3) might provide improved expression .
Media composition and growth conditions: Rich media like LB or 2xYT supplemented with appropriate antibiotics for plasmid selection. The culture should be well-aerated through vigorous shaking (200-250 rpm) to support high-density bacterial growth .
Researchers should conduct small-scale optimization experiments varying these parameters before scaling up to larger production volumes to ensure maximum yield of correctly folded protein.
For high-purity recombinant yebN protein, a multi-step purification strategy is recommended:
Affinity Chromatography: Nickel affinity chromatography is the primary method for His-tagged yebN purification. For membrane proteins like yebN, purification under denaturing conditions (using 8M urea or 6M guanidine hydrochloride) may be necessary to solubilize the protein from membranes . A stepwise imidazole gradient (20-500 mM) helps reduce non-specific binding while maximizing target protein recovery.
Size Exclusion Chromatography (SEC): Following affinity purification, SEC can remove aggregates and provide additional purification. Buffer conditions should be optimized to maintain protein stability, typically using Tris-based buffers with 50% glycerol for storage .
Ion Exchange Chromatography: As a polishing step, ion exchange chromatography can separate charged variants and contaminants with similar molecular weights but different charge properties.
Detergent Selection: Critical for membrane proteins, detergents like n-dodecyl-β-D-maltoside (DDM), n-octyl-β-D-glucopyranoside (OG), or CHAPS at concentrations above their critical micelle concentration help maintain protein solubility and native conformation.
Quality assessment using SDS-PAGE and western blotting with specific antibodies should be performed after each purification step. Yields of approximately 12 mg per liter of culture media have been reported for similar recombinant membrane proteins from E. coli using optimized protocols .
Verification of identity and integrity of purified recombinant yebN protein should employ multiple complementary techniques:
SDS-PAGE Analysis: Provides information about protein purity and apparent molecular weight. A single band at the expected molecular weight (approximately 20-22 kDa for native yebN, plus additional weight from fusion tags) indicates good purity .
Western Blotting: Using antibodies against either the yebN protein or the fusion tag (e.g., anti-His antibody) confirms protein identity. This technique is particularly useful for detecting degradation products or truncated forms of the protein .
Mass Spectrometry: Techniques such as MALDI-TOF or LC-MS/MS provide precise molecular weight determination and can confirm the amino acid sequence through peptide mapping after proteolytic digestion, verifying the complete amino acid sequence shown in search result .
Circular Dichroism (CD) Spectroscopy: Allows assessment of secondary structure content, which is particularly important for confirming proper folding of membrane proteins.
Functionality Assays: Though specific for each protein, these might include lipid binding assays, membrane insertion assays, or interaction studies with known binding partners to confirm that the purified protein retains biological activity.
N-terminal Sequencing: Edman degradation can confirm the N-terminal sequence and verify if the initiating methionine has been processed.
Researchers should maintain sample aliquots at -20°C or -80°C in a Tris-based buffer with 50% glycerol to preserve protein integrity, avoiding repeated freeze-thaw cycles which can lead to protein degradation .
Recombinant yebN offers potential as a component in multi-epitope vaccine development against E. coli O157:H7, following strategies similar to those employed with other outer membrane proteins:
Chimeric Protein Construction: Following the model of successful chimeric vaccines, yebN can be engineered as part of multi-component constructs. For example, combining yebN with immunogenic epitopes from other E. coli O157:H7 outer membrane proteins (like OmpA) and adjuvant components such as the B subunit of E. coli heat-labile enterotoxin (LTB) could enhance immunogenicity. These components would be connected using flexible peptide linkers selected from bioinformatics analyses of hundreds of potential linker sequences .
Epitope Identification: Computational analysis using epitope prediction tools can identify the most immunogenic regions of yebN likely to stimulate robust B-cell and T-cell responses. These selected epitopes, rather than the full-length protein, may be incorporated into vaccine constructs to focus the immune response on protective epitopes while minimizing reactogenic segments.
Adjuvant Co-delivery: As demonstrated with other E. coli membrane proteins, co-delivery with appropriate adjuvants significantly enhances immune responses. The LTB protein has proven effective as both a carrier and adjuvant in chimeric constructs .
Combination Strategies: Research with other outer membrane proteins (OmpA, OmpC, BamA) has shown that immunization with combinations of recombinant proteins elicits stronger protective immunity than single-protein vaccines, suggesting that yebN could be most effective as part of a multi-component formulation .
Delivery Platform Selection: Various delivery platforms including nanoparticles, virus-like particles, or attenuated live vectors could enhance the presentation of yebN epitopes to the immune system, potentially improving vaccine efficacy.
Researchers should validate vaccine candidates through in vitro neutralization assays followed by in vivo challenge studies in appropriate animal models to assess protective efficacy against E. coli O157:H7 infection.
While direct evidence for yebN's role in antimicrobial resistance is limited in the provided search results, several hypotheses can be proposed based on its membrane localization and the known resistance patterns of E. coli O157:H7:
Membrane Permeability Modulation: As a membrane protein, yebN may influence membrane permeability, potentially affecting the entry of antibiotics. Alterations in membrane protein composition are known mechanisms for reducing antibiotic penetration, particularly for hydrophilic antibiotics.
Efflux Pump Association: YebN could potentially interact with or modulate the activity of efflux pump systems, which are major contributors to multidrug resistance in Gram-negative bacteria. This hypothesis is supported by observations that E. coli O157:H7 isolates often show resistance to multiple antibiotics, including ampicillin and tetracyclines .
Biofilm Formation Contribution: Membrane proteins can influence bacterial adhesion and biofilm formation capabilities, which enhance antibiotic resistance. Investigating yebN's role in biofilm development could reveal indirect contributions to antimicrobial resistance.
Stress Response Involvement: YebN might participate in bacterial stress responses that are activated during antibiotic exposure, potentially contributing to adaptive resistance mechanisms.
To investigate these hypotheses, researchers could employ gene knockout or overexpression studies of yebN followed by antimicrobial susceptibility testing. Comparative proteomics between resistant and susceptible strains could also reveal correlations between yebN expression levels and resistance phenotypes. Additionally, structural studies of yebN might identify potential interaction sites with known resistance-mediating proteins.
Structural analysis of yebN can significantly advance antimicrobial development through several approaches:
Structure Determination Methods: Researchers should employ X-ray crystallography, cryo-electron microscopy, or NMR spectroscopy to resolve the three-dimensional structure of yebN. For membrane proteins like yebN, techniques such as lipidic cubic phase crystallization may be particularly effective.
Structure-Function Relationship Analysis: Identifying critical functional domains within yebN could reveal potential binding sites for small molecule inhibitors. Site-directed mutagenesis studies correlating structural features with bacterial survival or virulence would pinpoint the most promising targets.
In silico Drug Design: Once structural data is available, computational methods including molecular docking and virtual screening can identify compounds that bind to critical regions of yebN. Molecular dynamics simulations can further refine understanding of protein-ligand interactions.
Rational Inhibitor Design: If yebN proves essential for bacterial survival or virulence, structure-based design of peptide mimetics or small molecules that specifically inhibit its function could yield novel antimicrobial candidates with reduced risk of broad resistance development.
Allosteric Modulation Exploration: Beyond direct active site targeting, identifying allosteric sites on yebN that could modulate its function indirectly might provide additional therapeutic opportunities, potentially with different resistance profiles.
Comparative Analysis with Homologs: Structural comparison of yebN with homologous proteins in other bacteria could reveal conserved features across pathogens, potentially leading to broad-spectrum antimicrobials, while comparison with human proteins would help design selective agents with minimal host toxicity.
Membrane proteins like yebN present several significant challenges in expression and purification that require specialized approaches:
Protein Misfolding and Aggregation: Membrane proteins often misfold when overexpressed, forming inclusion bodies. This can be addressed by:
Reducing expression temperature (18-25°C)
Using specialized E. coli strains (C41/C43(DE3), engineered to better accommodate membrane protein overexpression)
Employing fusion partners that enhance solubility (MBP, SUMO, or Mistic tags)
Protein Toxicity: Overexpression of membrane proteins can disrupt host cell membrane integrity. Strategies to mitigate this include:
Using tightly regulated expression systems with minimal basal expression
Employing host strains with higher tolerance for membrane protein expression
Utilizing autoinduction media for gradual protein induction rather than IPTG shock
Extraction from Membranes: Solubilizing membrane proteins while maintaining native structure requires optimization of:
Detergent selection (screening multiple detergents like DDM, LDAO, OG)
Detergent concentration (typically 1-2% for extraction, reduced to just above CMC for purification)
Buffer composition (pH, salt concentration, addition of stabilizing agents)
Maintaining Stability During Purification: Membrane proteins often destabilize when removed from the lipid bilayer. This can be addressed by:
Adding lipids or lipid-like molecules during purification
Using bicelles or nanodiscs for structural studies
Incorporating glycerol (up to 50%) in storage buffers to prevent aggregation
Avoiding multiple freeze-thaw cycles by preparing single-use aliquots
Low Yields: Membrane proteins typically express at lower levels than soluble proteins. Researchers can improve yields by:
Scaling up culture volumes
Optimizing growth media composition
Fine-tuning induction parameters (cell density, inducer concentration, duration)
Employing high cell-density fermentation techniques
Using these approaches, yields of 12 mg per liter of culture media have been achieved for similar membrane proteins, providing sufficient material for downstream applications .
Analyzing interactions between yebN and other bacterial membrane components requires specialized approaches that maintain the native membrane environment or accurately mimic it:
Co-immunoprecipitation with Cross-linking: Chemical cross-linking prior to cell lysis can capture transient protein-protein interactions within the membrane. This approach involves:
In vivo cross-linking using membrane-permeable agents like formaldehyde or DSP
Solubilization with appropriate detergents
Immunoprecipitation using antibodies against yebN or its fusion tag
Mass spectrometry analysis of co-precipitated proteins
Bacterial Two-Hybrid Systems: Modified specifically for membrane protein interactions, these systems can detect interactions in vivo:
BACTH (Bacterial Adenylate Cyclase Two-Hybrid) system is particularly suitable for membrane protein interaction studies
Split-ubiquitin systems adapted for bacterial use
Förster Resonance Energy Transfer (FRET): Using fluorescently tagged versions of yebN and potential interaction partners to detect proximity-based energy transfer:
Constructs expressing yebN fused to donor fluorophores (e.g., CFP)
Potential interaction partners fused to acceptor fluorophores (e.g., YFP)
FRET efficiency measurements in intact cells or membrane preparations
Surface Plasmon Resonance (SPR): For in vitro interaction studies:
Immobilization of purified yebN on sensor chips in the presence of appropriate detergents or lipids
Flow of potential interaction partners over the immobilized protein
Real-time detection of binding events and determination of binding kinetics
Lipidomics and Lipid Interaction Studies: To identify specific lipid interactions:
Lipid binding assays using labeled lipids
Lipidomic analysis of lipids co-purifying with yebN
Effect of specific lipids on yebN stability and function
Native Mass Spectrometry: Recent advances allow analysis of membrane protein complexes:
Solubilization in MS-compatible detergents
Careful detergent removal prior to MS analysis
Identification of interaction partners and complex stoichiometry
These methodologies can reveal how yebN interacts with other proteins in functional complexes, potentially uncovering its role in bacterial membrane processes and identifying new targets for antimicrobial development.
To elucidate yebN's role in E. coli O157:H7 pathogenesis and virulence, researchers should employ a multi-faceted approach combining genetic, functional, and in vivo methods:
Gene Knockout and Complementation Studies:
Generate yebN deletion mutants using CRISPR-Cas9 or lambda Red recombinase systems
Create complemented strains by reintroducing the wild-type or mutant yebN genes
Compare growth kinetics, stress responses, and virulence factor expression between wild-type and mutant strains
Virulence Factor Expression Analysis:
Quantify expression of known virulence genes (e.g., Shiga toxin genes, LEE pathogenicity island components) in yebN mutants using qRT-PCR
Conduct proteomics analysis to identify global changes in protein expression resulting from yebN deletion
Monitor secretion of virulence factors using appropriate reporter systems
Adhesion and Invasion Assays:
Assess the ability of yebN mutants to adhere to and invade intestinal epithelial cell lines (e.g., Caco-2, HT-29)
Conduct competition assays between wild-type and mutant strains to identify fitness advantages
Evaluate biofilm formation capabilities on various surfaces
Host Response Studies:
Measure inflammatory responses in cell culture models exposed to wild-type versus yebN mutant strains
Assess cytokine production profiles using ELISA or multiplex cytokine assays
Evaluate effects on epithelial barrier integrity through transepithelial electrical resistance (TEER) measurements
In Vivo Infection Models:
Utilize mouse models of E. coli O157:H7 infection to compare colonization and pathology
Conduct competition assays between wild-type and yebN mutant strains in vivo
Investigate protection conferred by immunization with recombinant yebN protein
Phage Susceptibility Testing:
Determine if yebN mutations affect susceptibility to bacteriophages like SPEC13
Assess if phage therapy effectiveness is altered in strains with modified yebN expression
These complementary approaches would provide comprehensive insights into yebN's potential contributions to E. coli O157:H7 pathogenesis, potentially revealing new strategies for therapeutic intervention or preventive measures against this significant pathogen.
High-throughput screening (HTS) for yebN inhibitors requires specialized approaches due to the membrane protein target. The following methodologies would be most effective:
Whole-Cell Based Assays:
Growth inhibition assays using wild-type E. coli O157:H7 compared with yebN-overexpressing strains to identify compounds with differential activity
Reporter-based systems where yebN function is coupled to expression of fluorescent or luminescent reporters
Phenotypic screens monitoring bacterial processes potentially influenced by yebN (membrane integrity, stress response, virulence factor expression)
Target-Based Biochemical Assays:
Development of functional assays measuring the biochemical activity of purified yebN (if transport or enzymatic functions are identified)
Binding displacement assays using fluorescently labeled ligands known to interact with yebN
Thermal shift assays to identify compounds that alter protein stability upon binding
Biophysical Screening Approaches:
Surface Plasmon Resonance (SPR) to detect direct binding of compounds to immobilized yebN
Nuclear Magnetic Resonance (NMR)-based fragment screening to identify chemical scaffolds that interact with yebN
Mass spectrometry-based methods to detect compound binding
Virtual Screening and In Silico Approaches:
Structure-based virtual screening once yebN crystal structure becomes available
Ligand-based approaches using pharmacophore models if natural ligands are identified
Molecular dynamics simulations to identify potential binding pockets and evaluate ligand interactions
Microfluidic-Based Screening:
Droplet-based microfluidics to increase throughput and reduce sample consumption
Single-cell analysis to detect heterogeneous responses to potential inhibitors
Hit Validation and Optimization:
Secondary assays to confirm mechanism of action including mutant generation and resistance analysis
Structure-activity relationship studies to optimize potency and selectivity
Medicinal chemistry optimization focusing on membrane permeability and target selectivity
This comprehensive screening cascade would efficiently identify compounds that specifically inhibit yebN function, potentially leading to novel therapeutic agents against E. coli O157:H7 infections with mechanisms distinct from conventional antibiotics.
The potential of yebN as a diagnostic marker for E. coli O157:H7 detection depends on several factors that researchers would need to systematically investigate:
Specificity Analysis:
Comprehensive sequence analysis comparing yebN across various E. coli strains and related species to identify O157:H7-specific regions
Epitope mapping to develop antibodies recognizing serotype-specific portions of the protein
Validation using panels of diverse clinical isolates to confirm specificity
Detection Method Development:
ELISA-based detection using antibodies raised against recombinant yebN protein
Lateral flow immunoassays for rapid point-of-care or field testing
PCR-based methods targeting the yebN gene with serotype-specific primers
Multiplex Detection Strategies:
Combining yebN detection with established markers (Shiga toxin genes, O157 antigen) for improved accuracy
Development of bead-based multiplex assays for simultaneous detection of multiple markers
Integration with existing immunomagnetic separation (IMS) techniques currently used for E. coli O157:H7 isolation
Sensitivity Enhancement:
Signal amplification methods to improve detection limits
Sample preparation protocols optimized for different sample types (clinical specimens, food, water)
Pre-enrichment strategies to increase target concentration before detection
Validation Studies:
Comparison with gold standard methods (culture, PCR) using diverse sample types
Assessment of detection limits in complex matrices
Evaluation of false positive/negative rates in field conditions
Point-of-Care Applications:
Development of simplified extraction protocols compatible with resource-limited settings
Integration with portable detection platforms (smartphone-based readers, portable PCR)
Design of self-contained test kits requiring minimal technical expertise
Current rapid detection methods, such as the E. coli O157:H7 Rapid kit, demonstrate the feasibility of developing efficient diagnostic tools for this pathogen . The recombinant yebN protein, available at concentrations of 1-2 mg/mL after purification, could serve as an important reagent for assay development and standardization . With appropriate validation studies comparing performance to existing methods, yebN-based diagnostics could potentially enhance detection capabilities, particularly if they offer advantages in terms of speed, specificity, or ease of use.
Comparative genomic and proteomic analyses of yebN across E. coli pathotypes could reveal important insights about evolutionary adaptations and functional specialization through the following approaches:
Sequence Conservation Analysis:
Multiple sequence alignment of yebN across diverse E. coli pathotypes (EHEC, EPEC, ETEC, UPEC, AIEC)
Identification of conserved domains versus variable regions
Calculation of selection pressure (dN/dS ratios) to identify residues under positive or purifying selection
Mapping sequence variations to protein structural features to predict functional implications
Phylogenetic Reconstruction:
Construction of phylogenetic trees based on yebN sequences
Comparison with whole-genome phylogenies to identify horizontal gene transfer events
Analysis of yebN evolution in the context of E. coli pathotype emergence
Investigation of potential recombination events affecting yebN sequences
Genomic Context Analysis:
Examination of yebN flanking regions across different E. coli pathotypes
Identification of co-evolved gene clusters or operons containing yebN
Analysis of regulatory elements affecting yebN expression in different pathotypes
Identification of pathotype-specific genetic elements associated with yebN
Expression Pattern Comparison:
Transcriptomic analysis comparing yebN expression levels across pathotypes
Investigation of condition-specific expression (e.g., response to host environment, stress conditions)
Correlation of expression patterns with pathotype-specific virulence traits
Identification of regulatory networks controlling yebN in different contexts
Protein Modification Analysis:
Comparative proteomic analysis to identify post-translational modifications
Investigation of pathotype-specific protein interactions
Analysis of membrane localization patterns across different strains
Functional consequences of pathotype-specific variations
Structure-Function Relationship:
Modeling of yebN structural variations based on sequence differences
Prediction of functional implications for pathotype-specific adaptations
Experimental validation through chimeric protein construction and functional testing
These analyses could reveal whether yebN has undergone adaptive evolution in E. coli O157:H7 compared to commensal E. coli strains, potentially contributing to its virulence or environmental persistence. Such findings would not only enhance understanding of E. coli pathogenesis but could also identify pathotype-specific targets for diagnostic or therapeutic development. The discovery that certain outer membrane proteins from E. coli O78 provide cross-protection against heterologous strains including E. coli O157:H7 suggests evolutionary relationships in membrane protein structure and function that merit further investigation .