Recombinant Escherichia coli O157:H7 UPF0114 protein YqhA (yqhA)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Escherichia coli O157:H7 UPF0114 protein YqhA (yqhA) is a protein associated with the bacterium Escherichia coli O157:H7 . Escherichia coli O157:H7 is a major foodborne pathogen that causes severe disease in humans worldwide . Healthy cattle are a reservoir of E. coli O157:H7, and bovine food products and fresh produce contaminated with bovine waste are the most common sources for disease outbreaks . This bacterium expresses somatic (O) antigen 157 and flagella (H) antigen 7 .

E. coli O157:H7 possesses three overlapping AR systems, but the control and requirements for AR activity are different in each AR system . Other than these three AR systems, several proteins involved in AR of E. coli O157:H7 have been identified . These proteins include chaperone HdeA, RNA polymerase-associated protein SspA, and DNA-binding protein Dps .

Basic Properties

PropertyValue
Chemical NameRecombinant Escherichia coli O157:H7 UPF0114 protein YqhA (yqhA)
Molecular Weight0
MDL NumberN/A
CAS NumberN/A
Molecular FormulaN/A

Function and Pathways

YqhA is involved in several pathways and plays different roles in them . YqhA has several biochemical functions . It interacts directly with proteins and molecules, as detected by methods such as yeast two-hybrid, co-IP, and pull-down assays .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is finalized during production. If you require a particular tag, please specify it in your order; we will prioritize its development.
Synonyms
yqhA; ECH74115_4314; UPF0114 protein YqhA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-164
Protein Length
full length protein
Species
Escherichia coli O157:H7 (strain EC4115 / EHEC)
Target Names
yqhA
Target Protein Sequence
MERFLENAMYASRWLLAPVYFGLSLALVALALKFFQEIIHVLPNIFSMAESDLILVLLSL VDMTLVGGLLVMVMFSGYENFVSQLDISENKEKLNWLGKMDATSLKNKVAASIVAISSIH LLRVFMDAKNVPDNKLMWYVIIHLTFVLSAFVMGYLDRLTRHNH
Uniprot No.

Target Background

Database Links
Protein Families
UPF0114 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is UPF0114 protein YqhA and what is its role in E. coli O157:H7?

UPF0114 protein YqhA is a protein encoded by the yqhA gene in Escherichia coli, including the pathogenic O157:H7 strain. It belongs to the UPF (Uncharacterized Protein Family) 0114 class, indicating its function remains incompletely characterized. E. coli O157:H7 is a significant enterohemorrhagic strain that produces Shiga toxins and causes hemorrhagic colitis and hemolytic uremic syndrome in humans . While the specific function of YqhA in this pathogen has not been fully elucidated, understanding its role may provide insights into bacterial physiology and potentially pathogenicity mechanisms.

The protein has been successfully expressed recombinantly for research purposes, with expression systems including E. coli, yeast, baculovirus-infected insect cells, and mammalian cells . Research on UPF0114 protein YqhA contributes to the broader understanding of E. coli O157:H7, which remains a major public health concern in North America, Europe, and other regions worldwide .

What are the structural characteristics of YqhA protein?

The YqhA protein from E. coli O157:H7 consists of 164 amino acids (aa 1-164) . Its three-dimensional structure has been studied using crystallographic methods, though detailed structural information in public databases remains limited. The protein likely adopts a compact folding pattern typical of bacterial membrane-associated proteins.

To investigate YqhA's structure experimentally, researchers commonly employ:

  • X-ray crystallography after expression and purification

  • NMR spectroscopy for solution structure determination

  • Circular dichroism to assess secondary structure elements

  • Computational modeling validated against experimental data

For structural studies, high-purity protein samples are essential, and expression systems must be optimized to maintain native conformations. Researchers should consider post-translational modifications that might affect structure when selecting expression systems, as E. coli and yeast systems may provide different modification patterns than the native context .

What expression systems are most effective for recombinant YqhA production?

Multiple expression systems have been validated for YqhA production, each with distinct advantages:

Expression SystemYieldTurnaround TimePost-translational ModificationsRecommended Applications
E. coliHighShort (1-3 days)MinimalStructural studies, antibody production
YeastHighMedium (3-7 days)ModerateFunctional assays requiring some modifications
Baculovirus/InsectMediumLong (7-14 days)SubstantialStudies requiring authentic folding
MammalianLowVery long (14+ days)ComprehensiveFunctional studies requiring native conformation

What purification strategies optimize recovery of functional YqhA protein?

Effective purification of recombinant YqhA typically employs a multi-step approach:

  • Initial capture: Affinity chromatography using His-tag or GST-tag fusion constructs provides high specificity for initial purification from crude lysates.

  • Intermediate purification: Ion exchange chromatography separates YqhA from contaminants with different charge properties.

  • Polishing step: Size exclusion chromatography removes aggregates and ensures homogeneity of the final preparation.

For functional studies, researchers should carefully monitor protein activity throughout purification steps. A typical purification workflow might yield:

  • Crude lysate: 5-10% purity

  • After affinity chromatography: 70-85% purity

  • After ion exchange: 85-95% purity

  • After size exclusion: >95% purity

To maintain functionality, buffer optimization is critical. Stabilizing agents such as glycerol (10-15%) and reducing agents may help preserve native conformation. Researchers should validate purified protein through activity assays specific to the known or hypothesized function of YqhA.

How should researchers design experiments to investigate YqhA function?

When designing experiments to investigate YqhA function, researchers should implement a systematic approach:

  • Hypothesis formulation: Based on bioinformatic predictions, structural similarities to characterized proteins, or preliminary data.

  • Control selection: Multiple controls are essential, including:

    • Negative controls: Buffer-only, irrelevant protein of similar size/structure

    • Positive controls: Known functional proteins in the same pathway if available

    • Internal controls: Wild-type YqhA compared to site-directed mutants

  • Validation approach: Implement a multi-method validation strategy combining:

    • In vitro biochemical assays

    • Cell-based functional assays

    • In vivo models when appropriate

  • Replication strategy: Design should include both technical replicates (same sample, multiple measurements) and biological replicates (independent samples) .

For robust experimental design, researchers should consider using single-subject experimental designs (SSEDs) when appropriate, which can provide internally valid inferences through systematic manipulation of independent variables and measurement of dependent variables . The SSED approach is particularly valuable when investigating protein function in cellular systems where variability between experimental units is high.

What controls are essential when studying potential interactions of YqhA?

When investigating protein-protein or protein-substrate interactions involving YqhA, the following controls are critical:

  • Specificity controls:

    • Structurally similar but functionally distinct proteins from the same organism

    • Heat-denatured YqhA to distinguish specific from non-specific interactions

    • Competitive inhibition with excess unlabeled binding partners

  • Technical controls:

    • No-protein controls to identify background signals in detection systems

    • Tagged-only controls when using affinity tags for pull-down experiments

    • Concentration gradients to establish dose-dependency

  • Validation controls:

    • Orthogonal methods to confirm the same interaction (e.g., co-immunoprecipitation, FRET, SPR)

    • Domain deletion or point mutation variants to map interaction interfaces

The experimental design should include measurement by multiple assessors for at least 20% of data points to ensure reliability, with interassessor agreement meeting minimal thresholds . This approach helps minimize bias and confirms the reproducibility of observed interactions.

How might YqhA contribute to E. coli O157:H7 pathogenicity?

While the direct role of YqhA in E. coli O157:H7 pathogenicity remains under investigation, several mechanisms warrant exploration:

  • Potential host-pathogen interactions: YqhA may interact with host proteins or cellular structures during infection, potentially facilitating adherence, invasion, or immune evasion.

  • Stress response function: YqhA might contribute to bacterial survival under host-imposed stress conditions (oxidative stress, antimicrobial peptides, pH fluctuations).

  • Regulatory roles: YqhA could function in regulating expression of established virulence factors. E. coli O157:H7 produces Shiga toxins and causes hemorrhagic colitis and hemolytic uremic syndrome, with infections presenting a broad clinical spectrum from asymptomatic cases to life-threatening conditions .

  • Metabolic adaptation: The protein may facilitate metabolic adaptations required for colonization of the human intestinal tract.

Experimental approaches to investigate these possibilities include:

  • Comparative virulence studies with wild-type and yqhA knockout strains

  • Transcriptomic analysis to identify genes differentially expressed in response to YqhA modulation

  • Host cell interaction assays measuring adhesion, invasion, or cytotoxicity

  • Animal models of infection to assess colonization and disease progression

Understanding YqhA's contribution to pathogenicity requires consideration of the complex infection process of E. coli O157:H7, which typically begins with non-bloody diarrhea that may progress to bloody diarrhea or hemorrhagic colitis within 1-3 days .

What structural modifications of YqhA might affect its function?

Strategic structural modifications of YqhA can provide valuable insights into structure-function relationships:

  • Site-directed mutagenesis targets:

    • Conserved residues identified through multiple sequence alignments

    • Predicted active site residues based on structural modeling

    • Surface-exposed residues potentially involved in protein-protein interactions

    • Post-translational modification sites

  • Domain engineering approaches:

    • Truncation constructs to isolate functional domains

    • Domain swapping with homologous proteins

    • Fusion proteins to introduce reporter or affinity tags

  • Stability modifications:

    • Introduction of disulfide bridges to enhance stability

    • Surface entropy reduction to improve crystallization properties

    • Glycosylation site engineering when expressing in eukaryotic systems

Each modification should be systematically characterized using:

  • Stability assays (thermal shift, limited proteolysis)

  • Structural validation (CD spectroscopy, crystallography)

  • Functional assays specific to hypothesized YqhA activity

When designing mutants, researchers should consider the 164-amino acid sequence of YqhA (aa 1-164) and focus modifications on regions of interest identified through computational prediction or preliminary experimental data.

How should researchers address conflicting data in YqhA functional studies?

When confronting contradictory results in YqhA research, a systematic troubleshooting approach is recommended:

  • Methodological reconciliation:

    • Carefully compare experimental conditions between conflicting studies

    • Identify differences in protein preparation, purity, or storage

    • Evaluate detection methods and their sensitivity/specificity

    • Assess statistical power and sample sizes

  • Biological explanations:

    • Consider strain-specific differences in YqhA sequence or regulation

    • Evaluate potential context-dependent functions

    • Investigate post-translational modifications affecting activity

    • Examine protein-protein interactions that might modulate function

  • Resolution strategies:

    • Design experiments that directly address the source of conflict

    • Implement orthogonal methods to validate findings

    • Collaborate with laboratories reporting conflicting results

    • Consider environmental or experimental variables not previously controlled

When analyzing data, researchers should follow established standards for visual analysis to determine whether an experimental effect exists . This includes examining changes in level, trend, and variability between experimental phases, while also considering factors like latency of change that might question causality .

What statistical approaches are most appropriate for analyzing YqhA experimental results?

The selection of statistical methods should match the experimental design and data characteristics:

  • For comparative studies (e.g., wild-type vs. mutant YqhA):

    • Parametric tests (t-test, ANOVA) when assumptions of normality and homoscedasticity are met

    • Non-parametric alternatives (Mann-Whitney U, Kruskal-Wallis) when distributions violate parametric assumptions

    • Effect size calculations (Cohen's d, Hedges' g) to quantify the magnitude of differences

  • For dose-response or kinetic experiments:

    • Regression analysis to model relationships between variables

    • Non-linear curve fitting for enzyme kinetics or binding studies

    • Time series analysis for temporal data

  • For complex experimental designs:

    • Mixed-effects models to account for fixed and random effects

    • Multivariate approaches for simultaneous analysis of multiple dependent variables

    • Bayesian methods for incorporating prior knowledge and handling complex models

When implementing single-subject experimental designs, researchers should consider both visual analysis of graphed data and statistical analysis using techniques appropriate for serially dependent data . The specific approach should be determined during the experimental planning phase rather than post-hoc, to avoid statistical fishing expeditions.

What are promising areas for advanced YqhA research?

Future research on YqhA protein should prioritize several key directions:

  • Structural biology:

    • High-resolution structural determination using cryo-EM or X-ray crystallography

    • Dynamic structural studies using hydrogen-deuterium exchange or NMR

    • Computational modeling of protein dynamics and interactions

  • Systems biology approaches:

    • Network analysis of YqhA interactions within bacterial physiological systems

    • Multi-omics integration (proteomics, transcriptomics, metabolomics)

    • Synthetic biology applications for functional testing

  • Translational research:

    • Exploration of YqhA as a potential therapeutic target

    • Development of diagnostic applications based on YqhA detection

    • Vaccine research considering YqhA as a potential antigen

  • Comparative studies:

    • Cross-strain comparison of YqhA function in pathogenic versus non-pathogenic E. coli

    • Evolutionary analysis of UPF0114 family proteins across bacterial species

    • Host-pathogen interaction studies focusing on YqhA homologs

The design of these studies should incorporate replication of effects to establish internal validity, as single demonstrations of effect may be attributable to factors outside experimental control . Long-term research programs should build on established findings while systematically addressing gaps in current understanding.

How can researchers validate novel functions discovered for YqhA?

Validation of newly discovered YqhA functions requires a multi-faceted approach:

  • Independent replication:

    • Verification in different laboratories using standardized protocols

    • Testing across multiple E. coli strains to establish conservation of function

    • Replication using different methodological approaches

  • Genetic validation:

    • Gene knockout and complementation studies

    • Site-directed mutagenesis targeting residues critical for the proposed function

    • Conditional expression systems to modulate YqhA levels

  • Biochemical validation:

    • Purification of recombinant protein to homogeneity for in vitro functional assays

    • Structural studies confirming the protein possesses domains consistent with proposed function

    • Direct measurement of enzymatic activity or binding interactions

  • In vivo relevance:

    • Animal models of infection to assess the importance of YqhA function

    • Ex vivo tissue models to study interactions in more physiologically relevant contexts

    • Correlation with clinical isolates and outcomes

When designing validation studies, researchers should ensure their experimental phases include sufficient data points (at least 5 data points per phase for meeting standards, 3-4 points for meeting standards with reservations) . Multiple types of evidence should converge to support any novel functional claim.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.