Recombinant Escherichia coli O157:H7 UPF0208 membrane protein YfbV (yfbV)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yfbV; ECH74115_3434; UPF0208 membrane protein YfbV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-151
Protein Length
full length protein
Species
Escherichia coli O157:H7 (strain EC4115 / EHEC)
Target Names
yfbV
Target Protein Sequence
MSTPDNRSVNFFSLFRRGQHYSKTWPLEKRLAPVFVENRVIKMTRYAIRFMPPIAVFTLC WQIALGGQLGPAVATALFALSLPMQGLWWLGKRSVTPLPPAILNWFYEVRGKLQESGQVL APVEGKPDYQALADTLKRAFKQLDKTFLDDL
Uniprot No.

Target Background

Database Links
Protein Families
UPF0208 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is the UPF0208 membrane protein YfbV in E. coli O157:H7 and why is it significant for research?

    YfbV is a 151-amino acid inner membrane protein belonging to the UPF0208 protein family found in various E. coli strains, including the pathogenic O157:H7 serotype. Although not considered one of the primary virulence factors of E. coli O157:H7 (which include Shiga toxins, products of the locus of enterocyte effacement, and products of the F-like plasmid pO157), YfbV has biological significance as a membrane protein potentially involved in chromosome structure regulation .

    Research significance stems from understanding how conserved membrane proteins like YfbV function in pathogenic strains versus non-pathogenic E. coli variants. The study of YfbV can contribute to our understanding of membrane protein functions in bacterial pathogenesis, survival mechanisms, and potential targets for antimicrobial interventions.

  • What is currently known about the structure and topology of YfbV?

    The YfbV protein structure has been computationally modeled using methods such as AlphaFold, with a moderately high confidence score (pLDDT global: 82.42) . The protein contains predicted transmembrane regions consistent with its classification as an inner membrane protein.

    Topology analysis suggests YfbV has multiple membrane-spanning regions with both cytoplasmic and periplasmic domains. Researchers investigating membrane protein topology have demonstrated that experimental approaches combined with computational predictions can provide reliable topology models. For YfbV specifically, the protein exhibits structural features common to inner membrane proteins with potential regulatory functions .

    For experimental topology determination, C-terminal reporter fusions (such as PhoA and GFP) have proven effective for membrane proteins and could be applied to YfbV to validate computational predictions .

  • What cellular functions and pathways has YfbV been associated with?

    YfbV has been annotated as a "protein involved in regulation of chromosome structure" in database entries , though detailed mechanistic studies specifically on YfbV are somewhat limited in the current literature.

    The protein likely functions within membrane-associated pathways, potentially influencing chromosome organization, cell division, or stress responses. Understanding these functions requires:

    • Comparative genomics across E. coli strains to identify conserved functional domains

    • Knockout/complementation studies to observe phenotypic changes

    • Protein-protein interaction assays to identify binding partners

    • Transcriptomic analysis to determine regulatory networks

    Given that E. coli O157:H7 has adaptations for colonizing bovine gastrointestinal tracts and surviving in diverse environments , membrane proteins like YfbV may contribute to these capabilities through structural or regulatory roles.

Experimental Design and Methodology

  • What expression systems and purification strategies are optimal for recombinant YfbV protein production?

    Successful recombinant YfbV production requires careful consideration of expression systems and purification strategies. Based on published approaches for membrane proteins:

    Expression Systems Comparison:

    Expression SystemAdvantagesChallenges for YfbVRecommended Modifications
    E. coliHigh yield, economical, rapid growthPotential toxicity of homologous membrane proteinUse C41/C43 strains, regulate expression with tunable promoters
    YeastPost-translational modifications, eukaryotic machineryLower yields than bacterial systemsOptimize codon usage, use strong inducible promoters
    BaculovirusHandles complex membrane proteinsTime-consuming, expensiveConsider for structural studies requiring native conformation
    Mammalian cellsMost native-like protein foldingLowest yields, highest costReserve for functional studies requiring mammalian interactions

    For initial studies, E. coli-based expression with His-tagging appears effective based on commercial preparations . The purification workflow should include:

    1. Mild detergent solubilization (e.g., DDM, LDAO) to extract YfbV from membranes

    2. Affinity chromatography using His-tag

    3. Size exclusion chromatography to remove aggregates and improve purity

    4. Quality control by SDS-PAGE and Western blotting

    Lyophilization with trehalose as a stabilizing agent has been successfully used for storage , suggesting this approach preserves protein integrity.

  • How can researchers experimentally determine the membrane topology of YfbV?

    Membrane protein topology determination requires systematic experimental approaches. For YfbV, researchers should consider:

    1. Reporter fusion strategy: C-terminal reporter fusions to full-length YfbV using complementary reporters (PhoA for periplasmic exposure, GFP for cytoplasmic exposure) have been demonstrated as the most effective approach for bacterial inner membrane proteins . This method allows determination of C-terminal orientation and constrains topology prediction models.

    2. Cysteine scanning mutagenesis: Introduce cysteine residues at predicted loop regions and test accessibility to membrane-impermeable thiol-reactive reagents.

    3. Protease protection assays: Using spheroplasts or inverted membrane vesicles to determine which regions are protected from proteolytic digestion.

    4. Combined experimental-computational approach: Experimental data should be integrated with computational predictions using programs like TMHMM with constraints based on experimental results .

    Research has shown that C-terminal reporter fusions provide more consistent improvements in topology prediction performance than internal loop fusions . A systematic approach using PhoA and GFP fusions in a microtiter plate format would allow efficient determination of YfbV topology.

  • What biochemical techniques are most effective for characterizing YfbV interactions with other cellular components?

    Several complementary techniques can effectively characterize YfbV interactions:

    In vitro approaches:

    • Pull-down assays: Using His-tagged recombinant YfbV as bait to identify interaction partners from cell lysates

    • Surface plasmon resonance (SPR): For quantitative binding kinetics of purified interaction partners

    • Isothermal titration calorimetry (ITC): For thermodynamic characterization of binding interactions

    In vivo approaches:

    • Bacterial two-hybrid systems: Adapted for membrane protein interactions

    • Förster resonance energy transfer (FRET): Using fluorescently tagged proteins to detect proximity in live cells

    • Crosslinking followed by mass spectrometry: To capture transient interactions in native membranes

    Structural approaches:

    • Cryo-electron microscopy: For visualization of YfbV complexes

    • X-ray crystallography: If the protein can be crystallized, provides atomic resolution

    Since YfbV may participate in chromosome structure regulation , techniques to detect DNA-protein interactions (such as ChIP-seq) could also be valuable for understanding its function in the context of nucleoid organization.

Technical Challenges in YfbV Research

  • What are the challenges in purifying recombinant YfbV while maintaining its native conformation?

    Membrane proteins like YfbV present specific purification challenges:

    1. Detergent selection: Finding detergents that efficiently extract YfbV from membranes while preserving native structure requires screening. Mild detergents like DDM, LDAO, or Fos-choline may be suitable starting points.

    2. Protein aggregation: Membrane proteins tend to aggregate when removed from their lipid environment. Size exclusion chromatography and dynamic light scattering can monitor aggregation state.

    3. Maintaining stability: Buffer optimization (pH, salt concentration, additives) is critical. Commercial preparations use trehalose (6%) as a stabilizing agent for lyophilized YfbV .

    4. Conformational homogeneity: Ensuring a single, native-like conformation requires careful purification monitoring using techniques like circular dichroism or limited proteolysis.

    5. Lipid requirements: Some membrane proteins require specific lipids for function or stability. Co-purification with native lipids or reconstitution into liposomes might be necessary.

    6. Reconstitution systems: For functional studies, purified YfbV might need reconstitution into proteoliposomes, nanodiscs, or other membrane-mimetic systems.

    Analytical techniques such as circular dichroism, fluorescence spectroscopy, and differential scanning calorimetry can help monitor protein conformation and stability throughout purification.

  • How can researchers overcome expression and solubility issues when working with recombinant YfbV?

    Expression and solubility challenges for membrane proteins like YfbV can be addressed through systematic optimization:

    Expression optimization strategies:

    1. Strain selection: Use specialized E. coli strains designed for membrane protein expression (C41/C43, Lemo21)

    2. Expression temperature: Lower temperatures (16-25°C) often improve membrane protein folding

    3. Induction conditions: Test varying IPTG concentrations and induction times

    4. Media formulation: Specialized media (e.g., terrific broth with supplements) can improve yields

    5. Fusion partners: N-terminal fusions like MBP can improve solubility and expression

    Solubilization strategies:

    1. Detergent screening: Systematic testing of different detergent classes (maltoside, glucoside, fos-choline series)

    2. Solubilization conditions: Optimize parameters like detergent concentration, temperature, time, and buffer composition

    3. Stabilizing additives: Include glycerol, specific lipids, or ligands that might stabilize the protein

    4. Alternative solubilization: Consider styrene maleic acid lipid particles (SMALPs) for detergent-free extraction

    5. Co-expression strategies: Express with chaperones or binding partners that might stabilize YfbV

    Success has been reported with N-terminal His-tagged YfbV expressed in E. coli , suggesting this is a viable starting point. The expression and solubilization conditions will need optimization for specific experimental goals.

  • What analytical techniques can best resolve contradictions in YfbV functional studies?

    When facing contradictory results in YfbV research, consider these methodological approaches:

    1. Strain background effects: Perform experiments in multiple E. coli genetic backgrounds to identify strain-specific effects

    2. Growth condition variability: Standardize precise growth conditions (media, temperature, aeration, growth phase) across experiments

    3. Reporter system validation: Use complementary reporter systems (e.g., both PhoA and GFP fusions) to confirm topology findings

    4. Genetic complementation: Validate phenotypes of deletion mutants by reintroducing the gene on a plasmid

    5. Conditional depletion: Use inducible expression systems to circumvent adaptation to gene deletion

    6. Direct biochemical assays: Develop in vitro assays to directly test hypothesized functions

    7. Structural biology approaches: Resolve contradictory functional assignments through structure determination

    8. Systems biology integration: Combine transcriptomics, proteomics, and metabolomics to place YfbV in its cellular context

    9. Single-cell analysis: Address population heterogeneity that might explain contradictory bulk measurements

    10. Careful statistical analysis: Apply appropriate statistical methods and consider biological versus technical replicates

    For example, if contradictory results emerge regarding YfbV's topology, researchers could apply the systematic C-terminal fusion approach described in search result , which demonstrated that C-terminal reporter fusions to full-length proteins provided the most consistent topology determination results.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.