Recombinant Escherichia coli O157:H7 UPF0266 membrane protein yobD (yobD)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Escherichia coli O157:H7 UPF0266 Membrane Protein yobD

The Recombinant Escherichia coli O157:H7 UPF0266 membrane protein yobD (yobD) is a protein of interest due to its association with the pathogenic bacterium Escherichia coli O157:H7. This bacterium is known for causing severe foodborne illnesses, particularly hemorrhagic colitis and hemolytic uremic syndrome. Despite its importance, detailed information on the yobD protein is limited, and it is classified as a putative membrane protein with unknown function within the UPF0266 family .

Research Findings and Implications

While specific research on yobD is scarce, studies on other membrane proteins of E. coli O157:H7 highlight their critical roles in bacterial adhesion, survival, and pathogenicity. For example, the outer membrane protein A (OmpA) is known to facilitate bacterial adhesion to host cells . Although yobD's function is unknown, its classification as a membrane protein suggests potential involvement in similar processes.

ProteinFunctionImplication
OmpAAdhesion to host cellsPathogenicity enhancement
yobDUnknownPotential role in membrane processes

Challenges and Future Directions

  • Lack of Functional Data: The primary challenge in studying yobD is the absence of detailed functional data. Research efforts should focus on elucidating its role in E. coli O157:H7.

  • Recombinant Expression: Recombinant expression systems could be utilized to produce yobD for structural and functional studies, providing insights into its potential roles in bacterial physiology.

  • Pathogenicity Implications: Understanding yobD's function could reveal new targets for therapeutic interventions against E. coli O157:H7 infections.

Product Specs

Form
Supplied as a lyophilized powder.

Note: While we prioritize shipping the format currently in stock, please specify your format preference in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.

Note: Proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.

The specific tag type is determined during production. If you require a particular tag, please inform us; we will prioritize its implementation.
Synonyms
yobD; ECH74115_2549; UPF0266 membrane protein YobD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-152
Protein Length
full length protein
Species
Escherichia coli O157:H7 (strain EC4115 / EHEC)
Target Names
yobD
Target Protein Sequence
MTITDLVLILFIAALLAFAIYDQFIMPRRNGPTLLAIPLLRRGRIDSVIFVGLIVILIYN NVTNHGALITTWLLSALALMGFYIFWIRVPKIIFKQKGFFFANVWIEYSRIKAMNLSEDG VLVMQLEQRRLLIRVRNIDDLERIYKLLVSTQ
Uniprot No.

Target Background

Database Links
Protein Families
UPF0266 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does yobD from E. coli O157:H7 compare to similar proteins in other bacterial species?

YobD is conserved across various bacterial species with some sequence variations:

SpeciesProtein IDSimilarityKey Differences
E. coli O6P67602High (>90%)Conservative substitution at position 147 (E→K)
Yersinia pseudotuberculosisQ66BY5Moderate (~70%)Different N-terminal region and several substitutions throughout
Salmonella entericaA0A3Z2MXH8High (>85%)Minor variations in transmembrane regions

These differences suggest possible adaptations to specific bacterial membrane environments or functional specializations. Comparative analysis of these homologs can provide insights into conserved domains that might be essential for protein function .

What are the optimal conditions for expressing recombinant yobD in E. coli expression systems?

For optimal expression of recombinant yobD, the following methodological approaches have shown success:

  • Expression System Selection: T7 expression systems with BL21(DE3) host strains have demonstrated good results for membrane proteins like yobD, though pBAD-based systems offer tighter regulation and less physiological impact on E. coli .

  • Growth Parameters:

    • Temperature: 30°C rather than 37°C reduces inclusion body formation

    • Media: Terrific broth with 0.4% glycerol as carbon source

    • Cell density at induction: OD650 of approximately 0.5

    • Inducer concentration: Lower concentrations (0.015% arabinose for pBAD systems) yield better results than higher concentrations (0.2%)

  • Critical Timing: Harvest cells prior to glucose exhaustion, just before the diauxic shift. Studies show this significantly impacts membrane protein yields .

  • Expression Kinetics: Monitoring is essential - highest fluorescence values (when using GFP fusion constructs) are typically reached 4-6 hours after induction in the presence of glycerol .

The stress minimization approach (lower growth temperature, reduced inducer concentration) leads to slower growth and protein production rates, often enabling correct folding of membrane proteins like yobD .

How can researchers minimize inclusion body formation when expressing recombinant yobD?

Membrane proteins like yobD frequently form inclusion bodies during recombinant expression. To minimize this challenge:

  • Temperature Optimization: Reduce expression temperature to 30°C or even 25°C to slow protein synthesis and allow proper folding .

  • Fine-Tuning Expression Levels:

    • Use glucose repression with arabinose induction systems for "dampening" effect

    • A "fine-tuned" expression with 0.015% arabinose in the presence of glucose allows better control over expression rates

  • Co-expression Strategies:

    • Introduce chaperone proteins (e.g., GroEL/GroES, DnaK/DnaJ/GrpE)

    • Co-express membrane protein insertion machinery components

  • Fusion Tag Selection: GFP fusion constructs can help monitor proper folding in real-time and improve solubility .

  • Media Supplementation:

    • Add glycerol (0.4%) as a chemical chaperone

    • Include specific lipids that match the native membrane environment of yobD

Researchers should note that while these methods reduce inclusion body formation, some may still occur. The decision between optimizing for soluble expression versus inclusion body refolding should be made based on downstream applications .

What experimental approaches can be used to determine the function of the poorly characterized yobD protein?

Since yobD is a protein of unknown function, multiple complementary approaches should be employed:

  • Comparative Genomics and Bioinformatics:

    • Analyze genomic context around yobD in E. coli O157:H7

    • Examine conservation patterns across bacterial species

    • Apply machine learning protein function prediction tools

  • Targeted Mutagenesis:

    • Generate a yobD knockout strain and assess phenotypic changes

    • Create point mutations in conserved residues to identify critical functional domains

    • Perform complementation studies to verify function

  • Protein-Protein Interaction Studies:

    • Bacterial two-hybrid screening

    • Co-immunoprecipitation followed by mass spectrometry

    • Proximity labeling approaches (e.g., BioID)

  • Membrane Localization and Topology:

    • GFP fusion analysis for localization

    • Protease accessibility assays to determine membrane topology

    • Site-directed fluorescence labeling

  • Structural Biology Approaches:

    • X-ray crystallography (challenging for membrane proteins)

    • Cryo-electron microscopy

    • NMR spectroscopy for smaller domains

A comprehensive functional characterization would combine these approaches to generate testable hypotheses about yobD's role in E. coli O157:H7 physiology or pathogenicity .

How might yobD contribute to E. coli O157:H7 pathogenicity?

The potential role of yobD in pathogenicity can be investigated through several lines of evidence:

  • Comparative Expression Analysis:

    • YobD is present in the pathogenic E. coli O157:H7 proteome but expressed at low abundance levels, similar to many prophage-encoded proteins .

    • Studies comparing E. coli O157:H7 with its O55:H7 ancestor reveal evolutionary changes in membrane proteins that may contribute to pathogenicity .

  • Host-Pathogen Interaction Studies:

    • Assess yobD expression during infection of epithelial cells or in animal models

    • Determine if yobD interacts with host proteins or contributes to adhesion

  • Relationship to Virulence Factors:

    • E. coli O157:H7 causes bloody diarrhea, hemorrhagic colitis (HC), and hemolytic uremic syndrome (HUS)

    • Investigation of yobD's potential interaction with known virulence factors such as Shiga toxins or type III secretion system components

  • Membrane Integrity and Stress Response:

    • YobD may contribute to membrane integrity under stress conditions encountered during infection

    • Could play a role in antimicrobial resistance or survival in acidic environments

While direct evidence for yobD's role in pathogenicity is limited, its conservation in pathogenic strains warrants further investigation through knockout studies and virulence assays in appropriate model systems .

What are the advantages and disadvantages of different expression systems for recombinant yobD production?

Various expression systems offer distinct advantages for membrane protein expression:

How can researchers systematically optimize membrane protein production for structural and functional studies?

A systematic approach to membrane protein production optimization involves:

  • Factorial Design Experimentation:

    • Test combinations of temperature (25°C, 30°C, 37°C)

    • Vary inducer concentrations (e.g., 0.015%, 0.05%, 0.2% arabinose)

    • Evaluate different carbon sources (glycerol vs. glucose)

  • Real-Time Monitoring:

    • Use GFP fusion constructs for rapid assessment of expression and folding

    • Apply flow cytometry to measure production levels and cell viability

    • Monitor culture parameters (OD, CFU) to assess physiological impact

  • Harvest Timing Optimization:

    • Critical factor: harvest cells prior to glucose exhaustion and diauxic shift

    • Significant differences in yields can be observed with precise timing

  • Omics-Based Approaches:

    • Apply systems biology analysis to identify bottlenecks

    • Use transcriptomics, proteomics to assess cellular stress responses

    • Implement 'omics' based systems-level analysis for holistic approach

  • Strain Engineering:

    • Select specialized strains (C41/C43) designed for membrane protein expression

    • Consider genomically integrated expression systems for stability

This systematic approach moves beyond traditional trial-and-error methods that have dominated membrane protein expression, offering more reproducible results and higher success rates for challenging proteins like yobD .

How does E. coli O157:H7 yobD compare functionally with the yobD protein in ancestral E. coli O55:H7?

Comparative analysis between E. coli O157:H7 and its ancestral O55:H7 strain reveals evolutionary insights:

  • Evolutionary Context:

    • E. coli O157:H7 evolved from an O55:H7 precursor, with significant genomic changes

    • Estimation of divergence time: approximately 400 years using synonymous SNP analysis

  • Sequence Comparison:

    • YobD shows high conservation between these strains, suggesting important functional roles

    • Specific amino acid substitutions may reflect adaptation to different host environments

  • Expression Differences:

    • Proteomic studies reveal differential expression patterns between the strains

    • O157:H7 shows 50% more synonymous mutations compared to O55:H7, indicating accelerated evolution

  • Genomic Context Variations:

    • Different prophage integrations between strains (19 phage genomes in O55:H7 vs. 23 in O157:H7)

    • Only three phage elements are common to both strains, suggesting distinct evolutionary pressures

The high conservation of yobD between these strains, despite other significant genomic differences, suggests it may play an important role in basic bacterial physiology rather than being directly involved in the enhanced virulence of O157:H7 .

What insights can be gained from comparing yobD with homologous proteins in other bacterial species?

Cross-species comparison of yobD homologs reveals:

  • Conservation Patterns:

    • Core transmembrane domains show higher conservation than loop regions

    • Sequence alignment with homologs from E. coli O6 (P67602) and Yersinia pseudotuberculosis (Q66BY5) reveals conserved motifs

  • Structural Predictions:

    • All homologs maintain similar predicted membrane topology

    • Conservative substitutions predominate in transmembrane regions

    • Variable regions more common in cytoplasmic and periplasmic domains

  • Functional Implications:

    • Conservation across diverse bacterial species suggests fundamental cellular role

    • Variations in specific residues may reflect adaptation to different membrane compositions or environmental niches

  • Evolutionary Analysis:

    • Phylogenetic distribution correlates with bacterial taxonomy

    • Horizontal gene transfer appears limited for this membrane protein

This comparative approach can guide site-directed mutagenesis experiments by identifying both highly conserved residues (likely essential for function) and variable regions that might confer species-specific adaptations .

What are the main technical challenges in purifying and characterizing membrane proteins like yobD?

Working with membrane proteins presents several distinct challenges:

  • Solubilization Difficulties:

    • Hydrophobic nature requires detergents for extraction from membranes

    • Finding appropriate detergent that maintains native structure is challenging

    • Detergent screening typically required (e.g., DDM, LDAO, FC-12, CHAPS)

  • Stability Issues:

    • Membrane proteins often destabilize outside native lipid environment

    • Limited stability in detergent solutions hampers structural studies

    • Temperature sensitivity more pronounced than for soluble proteins

  • Purification Complications:

    • Detergent micelles complicate size-exclusion chromatography

    • Difficulty distinguishing between aggregated and properly folded protein

    • Lower yields compared to soluble proteins (typical yield: 12 mg per liter of culture media)

  • Structural Determination Barriers:

    • Crystallization more difficult due to limited polar surface for crystal contacts

    • Need for specialized techniques like lipidic cubic phase crystallization

    • Lower resolution in structural studies common for membrane proteins

  • Functional Assay Limitations:

    • Reconstitution into artificial membranes often needed for functional studies

    • Activity may depend on specific lipid compositions

    • Higher background in binding assays due to detergent interference

These challenges explain why membrane proteins like yobD remain less characterized despite their biological importance .

How can researchers differentiate between properly folded and misfolded recombinant yobD during expression and purification?

Distinguishing correctly folded membrane proteins from misfolded variants is crucial:

  • GFP Fusion Monitoring:

    • GFP fluorescence correlates with proper membrane protein folding

    • Flow cytometry analysis can quantify folding efficiency in real-time

    • Individual green fluorescence histograms can reveal partial induction or misfolding populations

  • Analytical Techniques:

    • Circular dichroism (CD) spectroscopy to assess secondary structure content

    • Size-exclusion chromatography profiles (sharp vs. broad peaks)

    • Thermal stability assays (e.g., differential scanning fluorimetry)

  • Detergent Resistance:

    • Properly folded membrane proteins retain structure in mild detergents

    • Resistance to SDS denaturation at room temperature (but not boiled)

    • Sequential extraction with increasingly harsh detergents

  • Fraction Analysis:

    • SDS-PAGE and western blotting of soluble vs. insoluble fractions

    • Quantifying percentage of cellular protein as soluble recombinant protein

    • Representative data shows properly folded protein in membrane fractions

  • Microscopy Approaches:

    • Fluorescence microscopy to visualize membrane localization

    • Inclusion body formation visible by phase contrast microscopy

    • Immunogold electron microscopy for precise subcellular localization

By combining these approaches, researchers can accurately assess the folding status of yobD and optimize conditions to maximize the yield of correctly folded protein .

What emerging technologies might improve the study of difficult-to-express membrane proteins like yobD?

Several cutting-edge technologies show promise for advancing membrane protein research:

  • Advanced Expression Platforms:

    • Cell-free expression systems with defined membrane mimetics

    • Synthetic minimal cells with customized translation machinery

    • Nanodiscs and amphipols for membrane protein stabilization

  • AI-Driven Optimization:

    • Machine learning algorithms to predict optimal expression conditions

    • Deep learning models for protein structure prediction (AlphaFold2/RoseTTAFold)

    • Computational design of stabilizing mutations

  • Single-Molecule Techniques:

    • High-speed atomic force microscopy for dynamic structural studies

    • Single-molecule FRET to study conformational changes

    • Nanopore recording for functional characterization

  • Advanced Imaging:

    • Cryo-electron tomography for in situ structural studies

    • Super-resolution microscopy for localization in bacterial membranes

    • Correlative light and electron microscopy approaches

  • Microfluidic Systems:

    • High-throughput screening of expression conditions

    • Droplet-based assays for functional characterization

    • Continuous cultivation with real-time monitoring

These technologies promise to overcome traditional barriers in membrane protein research, potentially revealing yobD's structure and function with unprecedented detail .

How might understanding yobD function contribute to developing new antimicrobial strategies against E. coli O157:H7?

The potential of yobD as an antimicrobial target depends on several factors:

  • Target Validation Approaches:

    • Essentiality testing through precise gene deletion

    • Conditional knockdown to assess growth phenotypes

    • Identification of synthetic lethal interactions

  • Structural Exploitation:

    • If structure is determined, rational drug design targeting yobD

    • Identification of binding pockets for small molecule inhibitors

    • Peptide-based inhibitors mimicking interaction partners

  • Functional Interference:

    • Disruption of specific yobD-mediated processes

    • Targeting regulatory pathways controlling yobD expression

    • Antibody-based approaches if yobD has extracellular domains

  • Epidemiological Significance:

    • E. coli O157:H7 causes bloody diarrhea, hemorrhagic colitis, and potentially fatal hemolytic uremic syndrome

    • Antibiotic treatment increases the risk of these complications, highlighting the need for alternative approaches

    • Target specificity across pathogenic strains must be assessed

  • Translational Potential:

    • Challenges in developing membrane protein-targeted drugs

    • Potential for combination therapies targeting multiple membrane proteins

    • Vaccine development if yobD proves to be surface-exposed and immunogenic

If yobD proves essential or important for pathogenicity, it could represent a novel target for antimicrobial development, particularly important given the risks associated with conventional antibiotic treatment of E. coli O157:H7 infections .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.