Recombinant Escherichia coli O157:H7 UPF0283 membrane protein ycjF (ycjF)

Shipped with Ice Packs
In Stock

Description

Introduction

Membrane proteins are vital for many cellular functions, including signal transduction, metabolism, and apoptosis . Studying the structure and function of membrane proteins is, therefore, critical in biotechnology, pharmacology, medical science, and fundamental biology . The UPF0283 membrane protein YcjF (YcjF) is a protein of unknown function that is found in Escherichia coli O157:H7 . Recombinant forms of this protein can be expressed and purified from various hosts, including E. coli and yeast .

Expression and Purification

Recombinant UPF0283 membrane protein YcjF (ycjF) can be expressed in different hosts, with E. coli and yeast offering the best yields and turnaround times . Insect cells with baculovirus or mammalian cells can provide the posttranslational modifications necessary for correct protein folding or retain the protein's activity .

Function and Structure Investigation

Studying membrane proteins involves purifying them from biological cells and reconstituting them into artificial membranes like liposomes or lipid vesicles . Various techniques, including cryo-electron microscopy, fluorescence-activated cell sorting, fluorescence spectrophotometry, NMR, and optical microscopy, are used to identify the structure and function of these reconstituted membrane proteins .

Table 1: Examples of Membrane Proteins Studied Using Reconstitution Methods

ProteinOrganismTypeTM RegionComplexTM NumberMethodMembrane Composition
BmrC/BmrDBacillus subtilisABC transporterα−helixBmrC/BmrD12detergent mediate reconstitutionDPhPC + DOPC/DOPE or DOPC/Sph/chol
BRHalophilic archaeaproton pumpα−helix7fusionEPC:EPA (9:1 [mol])
CXCR4Homo sapiensGPCR signaling proteinα−helixhomodimer14 (7 × 2)fusionDOPC
EmrEEscherichia colimultidrug transporterα−helixhomodimer8 (4 × 2)direct reconstitutionPOPC
OmpGEscherichia coliporinβ−strand14direct reconstitutionOuter membrane: DOPC Inner membrane: oleosin
OmpLAEscherichia coliphospholipaseβ−strandhomodimer24 (12 × 2)direct reconstitutionDOPC:DOPG (1:3)
PRSAR86 groupproton transportα−helix7direct reconstitutionPOPC
RCRhodobacter sphaeroideselectron transportα−helix10detergent mediate reconstitutionPOPC:POPG (9:1 [mol])
SLOStreptococcus pyogenestoxinα−helixhomo 36~40 mer36~40rehydrationPOPC, DOPC, SOPC, POPG

Artificial Cell Membranes

Artificial cell membranes composed of phospholipid bilayers are useful for studying membrane proteins . These membranes help to identify the structure, number of transmembrane domains, and functional type of the proteins .

Reconstitution Methods

Several methods exist for creating liposomes or lipid vesicles to reconstitute membrane proteins into artificial membranes .

  • Rehydration Method: This method involves solubilizing membrane proteins by mixing micelles of phospholipids and detergent . Proteo-small unilamellar vesicles (proteo-SUVs) are formed by reducing the detergent concentration . The solution is then dried on a glass substrate, and proteo-GUVs are generated by rehydrating the lipid film .

  • Electroformation Method: An improvement to the rehydration method, this technique involves preparing lipid films containing membrane proteins on ITO-coated glass . An AC electric field is applied to the hydrated lipid film to form proteo-GUVs .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ycjF; ECH74115_1967; UPF0283 membrane protein YcjF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Escherichia coli O157:H7 (strain EC4115 / EHEC)
Target Names
ycjF
Target Protein Sequence
MTEPLKPRIDFDGPLEVEQNPKFRAQQTFDENQAQNFAPATLDEAQEEEGQVEAVMDAAL RPKRSLWRKMVMGGLALFGASVVGQGVQWTMNAWQTQDWVALGGCAAGALIIGAGVGSVV TEWRRLWRLRQRAHERDEARDLLHSHGTGKGRAFCEKLAQQAGIDQSHPALQRWYASIHE TQNDREVVSLYAHLVQPVLDAQARREISRSAAESTLMIAVSPLALVDMAFIAWRNLRLIN RIATLYGIELGYYSRLRLFKLVLLNIAFAGASELVREVGMDWMSQDLAARLSTRAAQGIG AGLLTARLGIKAMELCRPLPWIDDDKPRLGDFRRQLIGQVKETLQKGKTPSEK
Uniprot No.

Target Background

Database Links
Protein Families
UPF0283 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How is the ycjF gene organized within the E. coli genome and what is its relationship to surrounding genes?

The ycjF gene exists within a functional gene cluster in E. coli known as the ycj operon. According to protein interaction network analysis, ycjF shows strongest interaction with ycjX (interaction score 0.999), suggesting they function as partners . The broader ycj gene cluster includes:

GeneFunctionRelationship to ycjF
ycjXDUF463 family protein, putative P-loop NTPaseDirect interaction partner (0.999 score)
ycjQ, ycjSSugar dehydrogenasesPart of same metabolic pathway
ycjT, ycjMSugar phosphorylasesPart of same operon
ycjUβ-phosphoglycomutasePart of same operon
ycjRSugar epimerase/isomerasePart of same operon
ycjN, ycjO, ycjP, ycjVTransport componentsPart of same ABC transport system
ycjWLacI-type repressorRegulatory component
OmpGOuter membrane porinAssociated with oligosaccharide import

This genomic organization strongly suggests ycjF functions within a carbohydrate metabolism and transport system .

What are the optimal expression systems and conditions for recombinant ycjF production?

For successful recombinant ycjF production, researchers should consider:

  • Expression system selection:

    • E. coli BL21(DE3) derivatives are commonly used for initial expression attempts

    • C41(DE3) and C43(DE3) strains are specifically designed for membrane protein expression

    • Cell-free systems may be considered for toxic membrane proteins

  • Expression construct optimization:

    • N-terminal His-tag fusion has been successfully used for ycjF purification

    • Codon optimization for the expression host

    • Signal sequence modifications may improve membrane targeting

  • Induction parameters:

    • Lower temperature induction (16-20°C) to reduce inclusion body formation

    • Reduced IPTG concentration (0.1-0.5 mM) for slower, more controlled expression

    • Extended expression time (16-24 hours) at lower temperatures

  • Media and supplements:

    • Rich media (TB, 2XYT) supplemented with glucose (0.4-1%)

    • Addition of membrane protein-specific supplements (glycerol 5-10%)

    • Trace metal supplementation for proper protein folding

The experimental design should include multiple expression conditions tested in parallel, with systematic optimization based on yield and solubility analysis4.

What purification strategies yield the highest purity and structural integrity of recombinant ycjF?

A multi-step purification strategy is required for isolating functional ycjF with high purity:

  • Membrane preparation:

    • Cell disruption via sonication or high-pressure homogenization

    • Separation of membrane fraction by ultracentrifugation (100,000×g, 1 hour)

    • Membrane solubilization with appropriate detergents

  • Affinity chromatography:

    • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin for His-tagged protein

    • Detergent screening table for membrane extraction:

    DetergentCMC (mM)AdvantagesConsiderations
    DDM0.17Mild, widely usedLarger micelles
    LMNG0.01Stabilizing, small micellesMore expensive
    Digitonin0.5Very mild, maintains complexesNatural product variability
    CHAPS8-10Compatible with many assaysHigher concentration needed
  • Size exclusion chromatography:

    • Separation based on size to remove aggregates and contaminants

    • Buffer optimization with detergent concentration above CMC but minimized

  • Quality control metrics:

    • SDS-PAGE analysis for purity assessment

    • Western blotting for identity confirmation

    • Dynamic light scattering for homogeneity evaluation

    • Circular dichroism for secondary structure confirmation

For ycjF specifically, researchers should be aware that lipidated forms may aggregate in solution, as observed with the related protein YcjN , and may require additional purification steps or detergent optimization.

What experimental approaches can determine the membrane topology of ycjF?

Determining ycjF's membrane topology requires complementary techniques:

  • Computational prediction:

    • Transmembrane helix prediction algorithms (TMHMM, Phobius)

    • Hydropathy plot analysis

    • Multiple sequence alignment of homologs to identify conserved transmembrane regions

  • Biochemical mapping approaches:

    • Cysteine scanning mutagenesis: Systematic replacement of residues with cysteine followed by accessibility testing with membrane-impermeable sulfhydryl reagents

    • Protease protection assays: Limited proteolysis of intact versus disrupted membranes followed by mass spectrometry analysis

    • Site-directed fluorescence labeling: Introduction of environment-sensitive fluorophores at specific positions

  • Genetic fusion approaches:

    • PhoA/LacZ fusion analysis (PhoA active when periplasmically located, LacZ active when cytoplasmically located)

    • GFP fusion analysis (GFP fluorescent only in cytoplasmic locations)

  • Structural analysis:

    • Cryo-electron microscopy of purified protein in nanodiscs or detergent

    • Solid-state NMR in reconstituted membrane environment

A systematic workflow should begin with computational prediction to guide the design of subsequent experimental validations, ultimately creating a complete topological map of ycjF's membrane orientation4.

How does ycjF contribute to E. coli O157:H7 function and potentially to pathogenesis?

While the precise function of ycjF remains undetermined, several approaches can elucidate its role:

  • Genetic approaches:

    • Construction of ycjF deletion mutants and complementation strains

    • Phenotypic characterization under various growth conditions

    • Transcriptomic analysis comparing wild-type and ΔycjF strains

  • Evolutionary context:

    • E. coli O157:H7 derived from O55:H7 approximately 400 years ago (using newer mutation rate estimates)

    • Comparative analysis shows O157:H7 lineage has undergone more genetic changes than O55:H7 (50% more synonymous substitutions)

    • Significant differences in membrane protein composition between pathogenic and non-pathogenic E. coli strains

  • Pathogenesis connection:

    • Based on the ycj cluster's involvement in carbohydrate metabolism , ycjF may contribute to nutrient acquisition in host environments

    • YcjF might participate in membrane integrity pathways relevant to acid resistance mechanisms, which are critical virulence factors for O157:H7

    • Its association with ycjX (interaction score 0.999) suggests potential involvement in shared physiological processes

  • Metabolic context:

    • The ycj gene cluster encodes enzymes involved in processing specific carbohydrates:

      • YcjS: 3-keto-D-glucoside dehydrogenase

      • YcjQ: 3-keto-D-guloside dehydrogenase

      • YcjR: C-4 epimerase converting 3-keto-D-gulopyranosides to 3-keto-D-glucopyranosides

    • YcjF may function within this metabolic pathway, potentially as a transporter or regulatory component

Experimental design should include phenotypic assays under conditions relevant to host environments (acid stress, bile exposure, limited carbon sources) and infection models comparing wild-type and ycjF mutant strains.

How can researchers address protein stability issues when working with recombinant ycjF?

Membrane proteins like ycjF present significant stability challenges that can be addressed through:

  • Buffer optimization:

    • Systematic screening of buffer components (pH 6.5-8.0, salt concentration 100-500 mM)

    • Addition of stabilizing agents (glycerol 5-20%, cholesteryl hemisuccinate 0.01-0.05%)

    • Testing various detergent types and concentrations

  • Thermal stability assessment:

    • Differential scanning fluorimetry to quantify unfolding temperatures under various conditions

    • Results should be analyzed using appropriate statistical methods as described in experimental design literature4

    • Example thermal stability data format:

    ConditionTm (°C)ΔTm (°C)Standard Deviation (n=3)
    Buffer A45.3-±0.7
    Buffer A + 10% glycerol48.6+3.3±0.5
    Buffer A + 5 mM lipid51.2+5.9±0.9
  • Lipid reconstitution approaches:

    • Incorporation into nanodiscs with defined lipid composition

    • Reconstitution into liposomes for functional studies

    • Use of amphipols or SMALPs (styrene maleic acid lipid particles) as alternatives to detergents

  • Protein engineering strategies:

    • Identification and mutation of surface-exposed cysteine residues

    • Introduction of stabilizing mutations based on homology modeling

    • Creation of fusion constructs with stabilizing protein partners

  • Storage optimization:

    • Flash-freezing in liquid nitrogen with cryoprotectants

    • Lyophilization protocols optimized for membrane proteins

    • Short-term storage at 4°C with preservatives to minimize freeze-thaw cycles

The statistical significance of stability improvements should be evaluated following principles in experimental design literature, ensuring sufficient replicates and appropriate controls4 .

What data analysis approaches help resolve contradictory findings in ycjF research?

When faced with contradictory results in ycjF studies, researchers should employ systematic data analysis strategies:

  • Meta-analysis framework:

    • Systematic review of methodology differences between contradictory studies

    • Statistical assessment of effect sizes across multiple experiments

    • Identification of moderator variables that may explain discrepancies

  • Statistical considerations:

    • Power analysis to ensure adequate sample sizes (reducing Type II errors)

    • Control for multiple comparisons to prevent Type I errors

    • Analysis of variability within and between experiments

  • Experimental validation approaches:

    • Independent replication by different research groups

    • Use of multiple complementary techniques to address the same question

    • Controlled variation of specific parameters to identify critical variables

  • Common sources of discrepancies in membrane protein research:

    • Detergent effects on protein conformation and activity

    • Expression system artifacts influencing post-translational modifications

    • Purification methods affecting native interacting partners

    • Buffer components masking or enhancing specific activities

  • Resolution workflow:

    • Define clear metrics for reconciling contradictory findings

    • Design decisive experiments targeting the specific contradictions

    • Consider protein heterogeneity (as seen with YcjN's lipidated forms) as potential explanation

When designing new experiments to resolve contradictions, researchers should carefully control variables following established principles in experimental design, ensuring adequate replication and statistical power4 .

How does ycjF compare structurally and functionally between pathogenic and non-pathogenic E. coli strains?

Comparative analysis of ycjF between E. coli strains reveals important evolutionary insights:

  • Sequence comparison:

    • Alignment of ycjF sequences from O157:H7 (pathogenic) and K-12 (non-pathogenic) strains

    • Identification of conserved domains versus variable regions

    • Calculation of amino acid substitution rates in different protein domains

  • Genomic context analysis:

    • While both pathogenic and non-pathogenic strains contain the ycj gene cluster, O157:H7 shows significant genomic differences from non-pathogenic strains:

      • 0.53 Mb of DNA is missing in O157:H7 compared to K-12

      • O157:H7 contains 463 phage-associated genes versus 29 in K-12

      • O157:H7 exhibits 50% more synonymous mutations compared to its O55:H7 ancestor

  • Functional implications:

    • Differences in ycjF may relate to adaptation to different ecological niches

    • In pathogenic strains, ycjF may contribute to specialized metabolism relevant to host environments

    • Cross-complementation experiments can test functional equivalence between variants

  • Evolutionary trajectory:

    • E. coli O157:H7 emerged relatively recently (approximately 400 years ago) from O55:H7

    • This evolutionary timeline provides context for understanding ycjF adaptations

    • Horizontal gene transfer and phage integration have significantly shaped O157:H7 genome

Understanding these differences provides important context for interpreting ycjF function and potentially explains conflicting experimental results when working with different E. coli strains.

What insights does the ycj gene cluster provide about coordinated protein function?

The ycj gene cluster represents a functional module revealing important principles about coordinated protein function:

  • Metabolic pathway organization:

    • YcjS, YcjQ, and YcjR form a sequential metabolic pathway for carbohydrate transformation:

      • YcjS: 3-keto-D-glucoside dehydrogenase (kcat = 22 s-1, kcat/Km = 2.3 × 104 M-1 s-1)

      • YcjQ: 3-keto-D-guloside dehydrogenase (kcat = 18 s-1, kcat/Km = 2.0 × 103 M-1 s-1)

      • YcjR: C-4 epimerase interconverting 3-keto-D-gulopyranosides to 3-keto-D-glucopyranosides

  • Transport system integration:

    • YcjN functions as a substrate-binding protein (structurally similar to maltose binding protein)

    • YcjO and YcjP are predicted transmembrane domains of an ABC transporter

    • YcjV functions as the nucleotide-binding domain

    • YcjF, as a membrane protein, may integrate with this transport machinery

  • Regulatory mechanisms:

    • YcjW is a LacI-type repressor likely controlling expression of the gene cluster

    • Transcriptional coordination ensures all necessary components are expressed together

    • Protein interaction network shows strong connection between YcjF and YcjX (0.999 score)

  • Evolutionary conservation pattern:

    • Bioinformatic analysis of YcjN indicates related proteins exist in both Bacteria and Archaea

    • Conservation patterns suggest functional importance of this system

    • Co-evolution analysis can identify functionally linked residues between ycjF and partner proteins

This coordinated gene cluster provides context for understanding ycjF function and suggests methodological approaches like co-expression studies, protein complex isolation, and metabolic analysis focused on carbohydrate processing pathways.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.