Recombinant Escherichia coli O157:H7 UPF0442 protein yjjB (yjjB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
yjjB; ECH74115_5876; UPF0442 protein YjjB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-157
Protein Length
full length protein
Species
Escherichia coli O157:H7 (strain EC4115 / EHEC)
Target Names
yjjB
Target Protein Sequence
MGVIEFLLALAQDMILAAIPAVGFAMVFNVPVRALRWCALLGSIGHGSRMILMTSGLNIE WSTFMASMLGGTIGIQWSRWYLAHPKVFTVAAVIPMFPGISAYTAMISAVKISQLGYSEP LMITLLTNFLTASSIVGALSIGLSIPGLWLYRKRPRV
Uniprot No.

Target Background

Database Links
Protein Families
UPF0442 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is UPF0442 protein yjjB in E. coli O157:H7?

UPF0442 protein yjjB is an uncharacterized protein found in Escherichia coli O157:H7, a pathogenic strain known for causing severe foodborne illness. The protein belongs to the UPF0442 family and is classified as a hypothetical protein, meaning its precise function remains to be fully elucidated . The "UPF" designation (Uncharacterized Protein Family) indicates that while the protein's sequence is known, its biological role has not yet been experimentally determined.

According to the available data, yjjB is a multi-pass membrane protein with a molecular weight of approximately 17,047 Da . The protein is encoded by the yjjB gene, which is located on the complementary strand of the E. coli O157:H7 chromosome at position NC_002655.2 (5489976..5490449) . Understanding this protein may provide insights into E. coli O157:H7 pathogenicity mechanisms, as membrane proteins often play crucial roles in bacterial survival and host interaction.

What is the known structure of yjjB protein?

The protein consists of 157 amino acid residues with the sequence starting with MGVIEFLLAL and ending with YRKRPRV . Based on sequence analysis and structural predictions, yjjB appears to be a membrane protein with multiple transmembrane domains, consistent with its subcellular localization in the cell membrane . The high confidence regions in the AlphaFold model (pLDDT > 90) represent areas where the structural prediction is most reliable, while any regions with lower scores may exhibit flexibility or disorder in the native protein .

For researchers interested in structural studies, examining the AlphaFold model can provide initial insights into potential functional domains and protein-protein interaction interfaces, which can guide experimental design for functional characterization studies.

How can recombinant yjjB protein be produced for experimental studies?

Recombinant production of yjjB protein for experimental studies can be accomplished through several expression systems, with E. coli being the most commonly used host . The methodology involves:

  • Gene Cloning: The yjjB gene sequence can be PCR-amplified from E. coli O157:H7 genomic DNA and cloned into an appropriate expression vector. Vectors containing N-terminal and/or C-terminal tags (such as His-tag, GST, or MBP) facilitate protein purification and detection .

  • Expression System Selection: While E. coli is the most common expression host, alternative systems including yeast, baculovirus, or mammalian cell lines may be considered depending on research requirements . Each system offers advantages for specific applications:

    Expression SystemAdvantagesConsiderations
    E. coliFast growth, high yield, economicalMay have issues with membrane protein folding
    YeastBetter for membrane proteins, eukaryotic PTMsSlower growth, lower yield than E. coli
    BaculovirusExcellent for complex proteins, mammalian-like PTMsMore technically challenging, time-consuming
    Mammalian cellsNative-like protein folding and PTMsHighest cost, lowest yield, technically demanding
  • Protein Purification: For membrane proteins like yjjB, specialized extraction protocols using detergents are required. Purification typically involves:

    • Cell lysis (mechanical disruption or detergent-based methods)

    • Membrane fraction isolation by ultracentrifugation

    • Solubilization with appropriate detergents

    • Affinity chromatography using the protein tag

    • Further purification by ion exchange or size exclusion chromatography to achieve >85% purity

  • Quality Control: SDS-PAGE analysis confirms protein purity (≥85% is standard for research applications) . Additional validation may include Western blotting, mass spectrometry, and functional assays.

For researchers specifically interested in antibody production, recombinant yjjB can be used as an immunogen, with antigen-affinity purification methods employed to generate specific antibodies .

What experimental methods are suitable for studying yjjB localization?

Several complementary experimental methods can be employed to study the subcellular localization of yjjB protein:

  • Fluorescence Microscopy: Using GFP fusion constructs, researchers can visualize the localization of yjjB within live bacterial cells. This approach requires creating a yjjB-GFP fusion protein while ensuring the tag does not interfere with membrane localization or protein function. Colocalization studies with known membrane markers can confirm membrane association.

  • Subcellular Fractionation: This biochemical approach involves separating bacterial cell components (cytoplasm, cell membrane, periplasm) through differential centrifugation, followed by Western blotting using anti-yjjB antibodies to detect the protein in specific fractions. Based on available data, yjjB is expected to be predominantly found in the membrane fraction .

  • Immunogold Electron Microscopy: For high-resolution localization studies, specific antibodies against yjjB coupled with gold particles can be used to visualize the precise localization of the protein at the ultrastructural level.

  • Protease Accessibility Assays: These experiments can determine the topology of membrane-embedded regions of yjjB by exposing intact cells or spheroplasts to proteases and analyzing which protein segments are protected from digestion.

  • Computational Prediction Validation: Experimentally validate the computational prediction that yjjB is a "multi-pass membrane protein" by using topology prediction algorithms in combination with experimental approaches like PhoA/LacZ fusion analysis or cysteine accessibility methods.

When designing localization experiments, researchers should consider controls to validate the specificity of detection methods, such as including a yjjB knockout strain and using appropriate markers for different cellular compartments.

What is known about the genetic context and regulation of the yjjB gene?

The yjjB gene in E. coli O157:H7 is located on the chromosome at position NC_002655.2 (5489976..5490449, complement) , indicating that it is encoded on the complementary strand. Its genetic context and regulation can be studied through several approaches:

  • Promoter Analysis: Identifying the promoter region upstream of yjjB can provide insights into its transcriptional regulation. Techniques such as 5' RACE (Rapid Amplification of cDNA Ends) can determine the transcription start site, while reporter gene assays (using constructs with the putative promoter region fused to reporter genes like lacZ or luciferase) can measure promoter activity under different conditions.

  • Transcriptional Profiling: RNA-seq or qRT-PCR can be used to quantify yjjB expression under various growth conditions, environmental stresses, or during host infection to identify conditions that modulate its expression. This approach may reveal physiological cues that regulate yjjB expression.

  • Operon Structure Analysis: Determining whether yjjB is part of an operon or independently transcribed can provide functional context. RT-PCR with primers spanning adjacent genes can identify co-transcribed genes.

  • Transcription Factor Binding: Techniques such as ChIP-seq (Chromatin Immunoprecipitation followed by sequencing) can identify transcription factors that bind to the yjjB promoter region, while electrophoretic mobility shift assays (EMSA) can confirm specific binding interactions.

  • Comparative Genomics: Analyzing the conservation and genomic context of yjjB across different E. coli strains can provide evolutionary insights and functional associations. Current data indicates that yjjB homologs are present in various E. coli strains, including pathogenic and non-pathogenic variants .

Understanding the regulation of yjjB may provide insights into its role in bacterial physiology or pathogenicity, particularly if its expression is modulated during specific physiological states or host infection.

What role might yjjB protein play in E. coli O157:H7 pathogenicity?

The potential role of yjjB protein in E. coli O157:H7 pathogenicity remains largely unexplored, but can be investigated through several methodological approaches:

  • Gene Knockout Studies: Creating yjjB deletion mutants and assessing their virulence in appropriate models can directly test its role in pathogenicity. Based on the search results, mice have been established as a useful model for studying E. coli O157:H7 pathogenesis . Comparing colonization efficiency, persistence, and host response between wild-type and ΔyjjB strains can reveal functional significance.

  • Transcriptional Response Analysis: RNA-seq experiments comparing gene expression in wild-type and yjjB mutant strains, particularly under conditions that mimic the host environment, can identify pathways affected by yjjB loss. Special attention should be paid to virulence genes, stress response pathways, and antimicrobial resistance mechanisms.

  • Host-Pathogen Interaction Studies: Since E. coli O157:H7 colonization involves interactions with intestinal mucus and epithelium , investigating whether yjjB affects adherence to epithelial cells, mucin production, or resistance to antimicrobial peptides (such as TAP and LAP observed in cattle infections) would be valuable. In vitro cell culture models with human or bovine intestinal epithelial cells can be employed for these studies.

  • Stress Response Assessment: Testing the yjjB mutant's resistance to various stresses encountered during infection (acid stress, bile salts, oxidative stress, antimicrobial peptides) can indicate whether yjjB contributes to bacterial survival in the host. This is particularly relevant as stress hormones can influence E. coli O157:H7 virulence mechanisms and colonization .

  • Immune Response Analysis: Examining how yjjB affects host immune responses, particularly cytokine profiles and antimicrobial peptide production, can provide insights into its role during infection. Prior research has shown that E. coli O157:H7 infection in cattle induces a Th1 immune response with increased IFNγ and decreased TGFβ expression , which could serve as a baseline for comparison.

The integrated analysis of these experiments could reveal whether yjjB functions as a virulence factor, a fitness factor that enhances survival in the host, or plays no significant role in pathogenicity.

How can structural studies of yjjB protein inform functional predictions?

Structural studies of yjjB protein can significantly advance functional predictions through several methodological approaches:

  • Comparative Structural Analysis: While a computational model of yjjB exists with high confidence (pLDDT score of 92.64) , experimental validation using techniques such as X-ray crystallography, cryo-electron microscopy, or NMR spectroscopy would provide higher resolution insights. Comparing the experimentally determined structure with the AlphaFold prediction can validate computational approaches and reveal functionally relevant features.

  • Structural Homology Analysis: Even in the absence of experimental structures, comparing the predicted yjjB structure with structurally similar proteins of known function can suggest potential roles. Structure-based similarity searches using tools like DALI or FATCAT may identify structural homologs that are not apparent from sequence comparisons alone.

  • Functional Site Identification: Structural analysis can reveal potential active sites, ligand-binding pockets, or protein-protein interaction interfaces. Computational tools such as CASTp, COACH, or FTMap can be used to identify cavities or binding sites in the yjjB structure that may indicate functional regions.

  • Molecular Dynamics Simulations: For membrane proteins like yjjB, molecular dynamics simulations within a lipid bilayer environment can provide insights into conformational dynamics, protein-membrane interactions, and potential transport functions. Particular attention should be paid to the behavior of transmembrane regions and potential channel or pore formations.

  • Structure-Guided Mutagenesis: Based on structural insights, targeted mutagenesis of conserved or functionally predicted residues can experimentally test their importance. For instance, if a potential binding pocket is identified, mutating key residues in that region followed by functional assays can validate structural predictions.

  • Protein-Ligand Docking: Computational docking studies can predict potential ligands or substrates that might interact with yjjB, generating testable hypotheses about its biochemical function. These predictions can guide experimental approaches such as binding assays or activity measurements.

By combining these structural approaches with biochemical and genetic methods, researchers can develop and test hypotheses about yjjB function based on its three-dimensional structure.

What experimental approaches can reveal protein-protein interactions involving yjjB?

Identifying protein-protein interactions (PPIs) involving yjjB can provide critical insights into its cellular function. Several complementary experimental approaches can be employed:

  • Bacterial Two-Hybrid (B2H) Systems: Unlike yeast two-hybrid systems, B2H is better suited for bacterial membrane proteins like yjjB. This approach involves creating fusion proteins with complementary fragments of a reporter enzyme (often adenylate cyclase) and screening for interactions with a library of E. coli proteins. Positive interactions reconstitute enzyme activity, leading to reporter gene expression.

  • Pull-Down Assays: Using recombinant tag-fused yjjB (as described in commercial offerings) as bait, researchers can capture interacting proteins from E. coli lysates. The interacting proteins can then be identified by mass spectrometry. For membrane proteins, careful consideration of detergent conditions is essential to maintain protein structure while solubilizing membrane complexes.

  • Co-Immunoprecipitation (Co-IP): Using antibodies against yjjB , native protein complexes can be immunoprecipitated from E. coli lysates and interacting partners identified by Western blotting or mass spectrometry. Chemical crosslinking prior to lysis can stabilize transient interactions.

  • Proximity Labeling: Techniques such as BioID or APEX2, where yjjB is fused to a biotin ligase or peroxidase, can identify proximal proteins in the cellular environment. These enzymes biotinylate nearby proteins, which can then be purified using streptavidin and identified by mass spectrometry.

  • Surface Plasmon Resonance (SPR): For validating and quantifying specific interactions, SPR can measure binding kinetics between purified yjjB and candidate interacting proteins. This approach requires recombinant protein production with high purity (≥85%) .

  • Förster Resonance Energy Transfer (FRET): For visualizing interactions in living cells, yjjB and putative interacting proteins can be tagged with fluorescent proteins capable of FRET. This allows real-time monitoring of interactions in their native membrane environment.

When analyzing results from these experiments, researchers should consider:

  • The membrane localization of yjjB may restrict its interaction network to other membrane proteins or proteins that transiently associate with membranes

  • Controls for non-specific binding are essential, particularly when using tagged proteins

  • Validation of interactions through multiple orthogonal methods increases confidence in results

How can mouse models be used to study yjjB function in E. coli O157:H7 infection?

Mouse models provide valuable tools for studying E. coli O157:H7 infection dynamics and the specific role of proteins like yjjB. Based on the provided literature, several methodological approaches can be implemented:

  • Colonization Pattern Studies: Comparing colonization patterns between wild-type and yjjB-deficient E. coli O157:H7 strains in mice can reveal the protein's impact on intestinal colonization. The search results indicate that in mice, E. coli O157:H7 colonizes the entire gastrointestinal tract with highest densities in the cecum and colon . Researchers should analyze bacterial densities in different intestinal segments (ileum, cecum, colon) from both digesta and mucus-associated populations using techniques such as fluorescence in situ hybridization (FISH) and culture-based methods .

  • Competitive Infection Assays: Co-infecting mice with wild-type and yjjB mutant strains (differentially tagged) allows direct comparison of their competitive fitness within the same host environment. This approach can reveal subtle phenotypes that might not be apparent in single-strain infections.

  • Host Response Analysis: Examining host immune responses to wild-type versus yjjB-deficient strains can indicate whether this protein influences host-pathogen interactions. Particular attention should be paid to:

    • Cytokine profiles, especially IFNγ and TGFβ, which have been shown to change during E. coli O157:H7 infection

    • Antimicrobial peptide production (TAP, LAP) in the intestinal epithelium

    • Mucin production in the intestinal tract, which increases in response to E. coli O157:H7 infection

  • Specialized Mouse Models: Several mouse models can be employed depending on the research question:

    • Streptomycin-treated mice: Enable colonization by reducing competing commensal flora

    • Germ-free mice: Allow study of E. coli O157:H7 in the absence of competing microbiota

    • Humanized microbiota mice: Better mimic the human intestinal environment

  • Epithelial Adherence Assessment: Since E. coli O157:H7 shows tissue-specific adherence patterns in mice (with highest adherence in ileum and cecum) , comparing epithelial adherence between wild-type and yjjB mutant strains can reveal whether yjjB affects this crucial virulence property. Techniques such as histological examination and confocal microscopy with fluorescently labeled bacteria can visualize adherence patterns.

  • Stress Hormone Studies: Given that stress hormones can affect E. coli O157:H7 virulence and colonization , investigating whether yjjB is involved in stress hormone sensing or response could provide mechanistic insights. This could involve exposing bacterial cultures to stress hormones before infection or manipulating host stress levels.

When designing these experiments, researchers should be aware that mouse models have limitations in reproducing certain aspects of human or bovine E. coli O157:H7 infections, but they remain valuable for mechanistic studies that would be challenging in larger animal models.

What bioinformatic approaches can aid in predicting yjjB function?

Advanced bioinformatic approaches can provide valuable insights into the potential function of uncharacterized proteins like yjjB. Methodological strategies include:

  • Phylogenetic Profiling: Analyzing the co-occurrence patterns of yjjB across diverse bacterial genomes can reveal functional associations. Proteins that consistently co-occur with yjjB across evolutionary lineages often participate in the same biological processes. This approach can identify functional networks even when direct sequence similarity to characterized proteins is low.

  • Genomic Context Analysis: Examining the genomic neighborhood of yjjB across different bacterial species can provide functional clues. Genes that are consistently found near yjjB may be functionally related, particularly if they form operons or gene clusters with coordinated expression patterns.

  • Protein Domain Analysis: While yjjB belongs to the UPF0442 family , deeper analysis of conserved domains, motifs, or structural features can suggest functional roles. Tools like InterPro, SMART, or Pfam can identify subtle domain signatures that might not be immediately apparent.

  • Structural Prediction Integration: Combining the high-confidence AlphaFold structural model (pLDDT score: 92.64) with structure-based function prediction tools like ProFunc, COFACTOR, or COACH can identify potential binding sites, catalytic residues, or structural similarity to proteins of known function.

  • Molecular Dynamics Simulations: For membrane proteins like yjjB, simulating its behavior within a lipid bilayer can reveal conformational dynamics and potential transport or signaling functions. Parameters to analyze include:

    • Channel or pore formation

    • Conformational changes in response to environmental stimuli

    • Stability of transmembrane helices

    • Interactions with membrane lipids

  • Expression Correlation Analysis: Mining transcriptomic datasets to identify genes whose expression patterns correlate with yjjB across different conditions can reveal functional relationships. This approach is particularly powerful when combined with network analysis to identify functional modules.

  • Protein-Protein Interaction Prediction: Computational tools like STRING, STITCH, or PrePPI can predict potential interaction partners of yjjB based on various evidence types, including co-expression, genomic context, and text mining of scientific literature.

When applying these bioinformatic approaches, researchers should integrate results from multiple methods to build a coherent functional hypothesis that can guide experimental validation efforts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.