Recombinant Escherichia coli O157:H7 UPF0761 membrane protein yihY (yihY)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Escherichia coli O157:H7 UPF0761 membrane protein YihY (yihY) is a bacterial membrane-associated protein produced through recombinant DNA technology. This protein is encoded by the yihY gene, which is also annotated as rbn (ribonuclease BN) in certain E. coli strains . YihY has been studied in the context of bacterial membrane biology and pathogenesis, particularly in the evolution and virulence mechanisms of E. coli O157:H7, a Shiga toxin-producing enterohemorrhagic E. coli (EHEC) strain linked to severe foodborne illnesses .

Table 1: Gene and Protein Information

PropertyDetails
Gene NameyihY (also rbn in some contexts)
UniProt IDB7L9D9
Protein Length290 amino acids (full-length recombinant form)
Host Systems for ProductionE. coli, Yeast, Baculovirus, Mammalian Cells
Purity≥85% (determined by SDS-PAGE)

YihY belongs to the UPF0761 family of uncharacterized membrane proteins, with structural predictions indicating multiple transmembrane domains . Its association with ribonuclease BN activity suggests potential roles in RNA processing or degradation .

Functional Roles and Pathogenic Context

YihY is implicated in the genomic evolution of E. coli O157:H7. Comparative genomic studies reveal that yihY is part of the conserved backbone genome shared between E. coli O157:H7 and its ancestral O55:H7 strain . Key findings include:

  • Phage-Related Evolution: E. coli O157:H7 contains 23 phage or phage-like elements, compared to 9 in O55:H7, with only three shared between the lineages. YihY may reside in regions affected by phage-mediated recombination .

  • Recombination Events: The divergence of O157:H7 from O55:H7 involved ~70 recombination events, potentially influencing yihY expression or function .

Table 2: Genomic Divergence Between E. coli O55:H7 and O157:H7

FeatureO55:H7O157:H7
Phage/Phage-Like Elements923
Synonymous MutationsLower50% higher than O55
Divergence Time~400 years (estimated)Derived from O55:H7

Production and Applications

Recombinant YihY is produced in multiple expression systems:

  • Membrane Protein Interactions: YihY’s structural homology to other E. coli membrane proteins (e.g., YidC) suggests a role in co-translational membrane insertion . YidC, a bacterial insertase, interacts with ribosomes to facilitate membrane protein biogenesis, a mechanism that may parallel YihY’s function .

  • Pathogenicity Links: While not directly linked to adhesion like Slp or Iha , YihY’s conservation in pathogenic E. coli strains implies a potential role in stress response or RNA metabolism during infection .

Outstanding Questions and Future Directions

  1. Functional Characterization: The enzymatic activity of YihY as ribonuclease BN remains unverified experimentally.

  2. Role in Virulence: Further studies are needed to determine if YihY contributes to E. coli O157:H7’s pathogenicity or environmental persistence.

  3. Structural Insights: High-resolution structural data (e.g., cryo-EM or crystallography) would clarify its mechanism of action .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yihY; ECH74115_5333; UPF0761 membrane protein YihY
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Escherichia coli O157:H7 (strain EC4115 / EHEC)
Target Names
yihY
Target Protein Sequence
MLKTIQDKARHRTRPLWAWLKLLWQRIDEDNMTTLAGNLAYVSLLSLVPLVAVVFALFAA FPMFSDVSIQLRHFIFANFLPATGDVIQRYIEQFVANSNKMTAVGACGLIVTALLLMYSI DSALNTIWRSKRARPKIYSFAVYWMILTLGPLLAGASLAISSYLLSLRWASDLNTVIDNV LRIFPLLLSWISFWLLYSIVPTIRVPNRDAIVGAFVAALLFEAGKKGFALYITMFPSYQL IYGVLAVIPILFVWVYWTWCIVLLGAEITVTLGEYRKLKQAAEQEEDDEP
Uniprot No.

Target Background

Database Links
Protein Families
UPF0761 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is YihY protein and what are its alternative designations?

YihY is classified as a UPF0761 membrane protein found in Escherichia coli O157:H7 and several other bacterial strains. The protein is also known by the gene name rbn (ribonuclease BN), indicating its potential enzymatic function. The UPF0761 classification suggests it belongs to a family of uncharacterized proteins with predicted functions that require further experimental validation. YihY appears to be conserved across multiple E. coli strains including O157:H7, O127:H6, O81, O7:K1, and others, suggesting an important physiological role . The protein is encoded by the yihY gene and has been associated with membrane-related functions in gram-negative bacteria.

What expression systems are suitable for producing recombinant YihY protein?

Recombinant YihY protein can be produced using several expression systems, each with distinct advantages depending on research objectives:

Expression SystemAdvantagesConsiderations
E. coliHigh yield, cost-effective, rapid growthMay require optimization of Sec translocon capacity for membrane proteins
YeastPost-translational modifications, eukaryotic environmentSlower growth, more complex media requirements
BaculovirusHigher-order protein folding, suitable for toxic proteinsMore technically demanding, longer production timeline
Mammalian CellNative-like folding, complex post-translational modificationsHighest cost, slowest growth, specialized expertise required
Cell-Free ExpressionAvoids toxicity issues, rapid productionLower yields, higher cost per mg

The choice of expression system should be determined by experimental requirements, with consideration of the membrane protein nature of YihY. For basic characterization studies, E. coli expression systems often provide sufficient yields, while advanced structural or functional studies might benefit from eukaryotic expression systems .

How can I assess the purity and integrity of recombinant YihY protein preparations?

Standard purity assessment for recombinant YihY involves SDS-PAGE analysis, with acceptable preparations typically showing ≥85% purity . For comprehensive quality assessment, researchers should implement a multi-method approach:

  • SDS-PAGE: Provides visual confirmation of protein size and approximate purity

  • Western blotting: Confirms protein identity using specific antibodies

  • Size exclusion chromatography: Evaluates oligomeric state and aggregation profile

  • Mass spectrometry: Verifies exact molecular weight and potential modifications

  • Circular dichroism: Assesses secondary structure integrity

  • Functional assays: Confirms biological activity if enzymatic function is known

For membrane proteins like YihY, additional detergent screening and stability assays may be necessary to ensure the protein maintains its native conformation throughout purification and subsequent experiments.

What strategies can optimize YihY translocation to the periplasm during recombinant expression?

Optimizing YihY translocation to the periplasm requires careful consideration of the secretory pathway mechanics. When expressing membrane proteins like YihY, harmonizing gene expression intensity with Sec translocon capacity is critical for achieving high yields of properly localized protein .

Implementation strategies include:

  • Signal sequence selection: The DsbA signal sequence directs secretory proteins to the Sec translocon in an SRP-dependent fashion and is widely used for recombinant secretory protein production. This cotranslational targeting approach prevents cytoplasmic misfolding of the target protein .

  • Expression level tuning: Unlike cytoplasmic proteins where maximum expression is often desirable, membrane proteins require balanced expression to prevent Sec translocon saturation. Titratable promoters rather than strong T7-based systems may improve translocation efficiency .

  • Sec translocon components monitoring: Track levels of SecY, SecE, SecA, and auxiliary component YidC during expression optimization. Imbalanced accumulation of these components (increased SecY and SecA with decreased SecE) indicates potential Sec translocon saturation .

  • Culture condition optimization: Lower temperatures (16-25°C) and reduced inducer concentrations can improve membrane protein folding and insertion by slowing production rate to match translocation capacity.

Research has demonstrated that non-optimized membrane protein production conditions lead to precursor accumulation in the cytoplasm and ultimately to mutations that reduce target gene expression, indicating the importance of this harmonization approach .

What experimental approaches can determine if YihY maintains viability and functionality after recombinant production?

Assessing viability and functionality of recombinant YihY requires specialized techniques that distinguish between total protein production and properly folded, functional protein:

  • Propidium monoazide (PMA) real-time PCR assay: This technique can be adapted to assess protein viability by distinguishing between total and viable protein fractions, similar to its application in bacterial viability studies .

  • Reconstitution into proteoliposomes: For membrane proteins like YihY, functionality often depends on proper membrane insertion. Reconstitution into artificial lipid bilayers followed by functional assays can verify native-like activity.

  • Binding and activity assays: If YihY functions as ribonuclease BN as suggested by its alternative name (rbn), RNA degradation assays can confirm functionality. Substrate specificity profiles and kinetic parameters should be established.

  • Structural integrity assessment: Techniques such as limited proteolysis can detect properly folded domains versus misfolded regions, providing insight into the protein's structural integrity after recombinant production.

Experimental data consistently shows that standard culturing methods may underestimate viable protein compared to more sensitive techniques like PMA-based approaches. For instance, studies with E. coli O157:H7 demonstrated that viable cell quantities determined by PMA real-time PCR were approximately 10,000-fold greater than found by colony enumeration methods .

How do different E. coli O157:H7 strains compare regarding YihY expression and membrane localization efficiency?

Comparative analysis of YihY expression across E. coli O157:H7 strains reveals strain-specific variation in expression efficiency and proper membrane localization. When designing experiments to investigate these differences, researchers should consider:

  • Genomic context analysis: Examine the organization of the yihY gene locus across different O157:H7 isolates to identify potential regulatory elements affecting expression.

  • Quantitative proteomics approach: Implement stable isotope labeling or label-free quantitation to measure relative YihY abundance in membrane fractions across strains.

  • Fluorescent fusion protein tracking: Create YihY-GFP fusions to visualize membrane localization in real-time across different strains.

  • Complementation studies: Perform cross-strain complementation with yihY variants to identify strain-specific factors affecting proper membrane insertion.

When comparing virulent strains like EC4045 with non-toxigenic strains like ATCC 700728, researchers should monitor differences in membrane protein processing that may correlate with pathogenicity traits. Environmental conditions such as relative humidity have been shown to affect E. coli O157:H7 viability and could similarly impact membrane protein expression dynamics .

What are the critical parameters for designing YihY mutation studies to investigate structure-function relationships?

Designing effective YihY mutation studies requires systematic planning to establish structure-function relationships. Critical experimental parameters include:

ParameterConsiderationsMethodological Approach
Mutation SelectionConserved residues across UPF0761 familyMultiple sequence alignment with other UPF0761 proteins
Mutation StrategyIndividual vs. combinatorial mutationsAlanine scanning followed by targeted substitutions
Expression SystemMaintaining membrane localizationComparison of periplasmic vs. cytoplasmic expression
Functional ReadoutQuantifiable activity metricsDevelopment of specific ribonuclease activity assays
Structural Impact AssessmentEffects on protein folding and stabilityThermal shift assays, limited proteolysis

When implementing these studies, researchers should establish robust controls including wild-type protein expression under identical conditions and non-related membrane protein controls to distinguish specific from general membrane protein effects. If YihY functions as ribonuclease BN, mutation studies should focus on potential catalytic residues and substrate binding regions to establish the molecular basis for enzymatic activity .

How should researchers approach experimental design when investigating YihY protein interactions with host cellular components?

Investigating YihY interactions with host cellular components requires multi-faceted experimental approaches that account for the challenges of membrane protein research:

  • In vivo crosslinking: Implement chemical crosslinking followed by immunoprecipitation to capture transient interactions in the native membrane environment. This approach can identify components of the Sec translocon (SecY, SecE, SecA) that may interact with YihY during membrane insertion .

  • Bacterial two-hybrid systems: Modified for membrane proteins, these systems can screen for potential protein partners in a high-throughput manner.

  • Co-purification studies: Mild detergent solubilization followed by affinity purification can identify stable interacting partners.

  • Genetic interaction mapping: Synthetic genetic array analysis can identify genes whose products functionally interact with YihY.

When designing these experiments, researchers must consider the dynamic nature of membrane protein interactions and implement appropriate controls to distinguish specific from non-specific membrane protein associations. The potential role of YihY in pathogenicity (indicated by its presence in virulent strains like O157:H7) suggests that interaction studies should examine both housekeeping cellular components and potential virulence-associated factors .

What methodological approaches can resolve contradictory data regarding YihY function in different experimental systems?

When confronting contradictory data about YihY function across experimental systems, researchers should implement systematic troubleshooting and reconciliation strategies:

  • Expression system comparison: Directly compare YihY produced in different systems (E. coli, Yeast, Baculovirus, Mammalian cells) using identical characterization methods to isolate system-specific effects .

  • Detergent screening: Test multiple detergents for protein extraction to identify conditions that best preserve native conformation and function.

  • Environmental parameter standardization: Establish standardized buffer conditions, temperature, and pH for functional assays to eliminate variation from these factors.

  • Domain-specific analysis: Express and characterize individual domains to identify region-specific functions that might be differentially affected in various expression systems.

  • In vivo validation: Develop genetic complementation assays in E. coli to validate in vitro findings in a native-like environment.

When analyzing data, researchers should consider that apparent contradictions may reflect biological reality—YihY might possess different activities under different conditions or in different cellular compartments. The membrane localization of YihY suggests its function may be regulated by lipid composition or membrane potential, which vary across experimental systems .

What mass spectrometry-based approaches are most effective for characterizing post-translational modifications of YihY protein?

Characterizing post-translational modifications (PTMs) of membrane proteins like YihY requires specialized mass spectrometry approaches:

  • Sample preparation optimization: Implement membrane protein-specific digestion protocols using complementary proteases (trypsin, chymotrypsin, and elastase) to improve sequence coverage of hydrophobic regions.

  • Enrichment strategies: For phosphorylation analysis, use titanium dioxide (TiO2) or immobilized metal affinity chromatography (IMAC); for glycosylation, employ lectin affinity chromatography before MS analysis.

  • MS/MS fragmentation methods: Combine collision-induced dissociation (CID), electron transfer dissociation (ETD), and higher-energy collisional dissociation (HCD) to maximize PTM site identification and localization confidence.

  • Quantitative approaches: Implement stable isotope labeling or label-free quantitation to compare PTM abundance across different conditions or bacterial strains.

  • Top-down proteomics: Analyze intact YihY protein to preserve labile modifications and identify proteoforms with multiple PTMs.

For membrane proteins specifically, researchers should pay special attention to potential lipid modifications and carefully control for artifacts introduced during membrane extraction and purification processes. The functional significance of identified PTMs should be validated through mutagenesis and complementation studies .

How can researchers develop reliable functional assays to characterize the enzymatic activity of YihY as a potential ribonuclease?

Developing reliable functional assays for YihY's potential ribonuclease activity requires careful consideration of substrate specificity, reaction conditions, and detection methods:

  • Substrate selection: Test multiple RNA substrates including:

    • Synthetic oligonucleotides with various structures (single-stranded, hairpins, duplexes)

    • Natural RNA substrates (tRNA, rRNA fragments, mRNA)

    • Fluorescently labeled RNA for real-time monitoring

  • Reaction condition optimization:

    • Buffer composition (ionic strength, divalent cations, pH)

    • Temperature and incubation time

    • Detergent concentration (critical for membrane protein activity)

  • Activity detection methods:

    • Gel-based assays with radiolabeled or fluorescently labeled RNA

    • FRET-based real-time assays for kinetic analysis

    • Mass spectrometry to identify cleavage products and specificity

  • Specificity determination:

    • Competition assays with known ribonuclease substrates

    • Inhibitor profiling with ribonuclease inhibitors

    • Sequence preference analysis using substrate libraries

When establishing these assays, researchers should incorporate appropriate controls including known ribonucleases (RNase A, RNase T1) and catalytically inactive YihY mutants. The membrane association of YihY suggests that activity might be modulated by lipid composition, so assays in the presence of various lipid environments should be considered .

What are the potential connections between YihY function and E. coli O157:H7 pathogenicity in human infections?

Exploring connections between YihY and E. coli O157:H7 pathogenicity requires integrating molecular microbiology with infection biology approaches:

  • Comparative genomics analysis: Compare yihY gene sequences and expression patterns between pathogenic O157:H7 and non-pathogenic E. coli strains to identify pathogenicity-associated variants.

  • Infection model studies: Develop in vitro epithelial cell infection models to compare wild-type and YihY-deficient E. coli O157:H7 strains regarding:

    • Adherence efficiency

    • Invasion capability

    • Host cell response modulation

    • Survival within host cells

  • Transcriptomic analysis: Perform RNA-Seq on host cells infected with wild-type versus YihY-deficient strains to identify differentially regulated host response pathways.

  • Protein-protein interaction screening: Identify potential interactions between YihY and host cell proteins using techniques adapted for membrane proteins.

The virulence factor BrkB family relation noted in some annotations of YihY homologs suggests potential involvement in pathogenicity mechanisms . Research has demonstrated that E. coli O157:H7 survival on surfaces like lettuce is complex, with viable but non-culturable states potentially contributing to virulence, suggesting YihY might play a role in environmental persistence or stress adaptation .

How can structural biology approaches be adapted to determine the three-dimensional structure of YihY membrane protein?

Determining the three-dimensional structure of membrane proteins like YihY presents unique challenges requiring specialized approaches:

  • X-ray crystallography optimization:

    • Detergent screening to identify conditions that yield well-diffracting crystals

    • Lipidic cubic phase (LCP) crystallization as an alternative to detergent-based approaches

    • Fusion protein strategies (T4 lysozyme fusion) to increase soluble domains for crystal contacts

  • Cryo-electron microscopy (cryo-EM) approaches:

    • Preparation in nanodiscs or amphipols to maintain native-like lipid environment

    • Implementation of the latest direct electron detectors and image processing algorithms

    • Potential for studying YihY in complex with interaction partners

  • NMR spectroscopy adaptations:

    • Solution NMR in detergent micelles for smaller membrane proteins or domains

    • Solid-state NMR for YihY reconstituted in lipid bilayers

    • Selective isotope labeling to focus on specific regions of interest

  • Integrative structural biology:

    • Combine lower-resolution techniques (SAXS, crosslinking-MS) with computational modeling

    • Leverage evolutionary constraints through co-evolution analysis

    • Validate structural models through targeted mutagenesis and functional assays

When implementing these approaches, researchers should consider the UPF0761 family characteristics and prioritize stabilizing conditions that maintain YihY's native conformation. The ≥85% purity achievable for recombinant YihY provides a solid starting point for structural studies, though further purification may be required for crystallography or cryo-EM .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.