Recombinant Escherichia coli O157:H7 Zinc transport protein ZntB (zntB)

Shipped with Ice Packs
In Stock

Description

Function and Transport Mechanism

ZntB is involved in zinc transport . Zinc is an essential microelement for sustaining life, but excess zinc is toxic; therefore, dedicated import, export, and storage proteins tightly regulate zinc concentration . ZntB mediates Zn2+ transport, which is stimulated by a pH gradient across the membrane . ZntB most likely mediates Zn2+/H+ co-transport, indicating it functions as a zinc importer . Studies show that the same fold within the CorA superfamily can be used either as a channel (CorA) or a transporter (ZntB) .

Structure

The full-length structure of the ZntB transporter is a member of the CorA MIT family . The protein encoded by the zntB locus is homologous to the CorA family of Mg 2+ transport proteins and is widely distributed among the eubacteria . Crystal structures are available of only cytoplasmic parts of ZntB .

Role in Zinc Homeostasis

ZntB is important for maintaining Zn2+ homeostasis in Enterobacteria . Several membrane transporters in Enterobacteriaceae are involved in zinc homeostasis and linked to virulence . ZntB helps regulate bacterial zinc concentrations and could be a target for new antimicrobial drugs, as zinc is critical to both human and pathogenic bacterial viability, and inhibiting zinc uptake could combat illness .

ZntB as a Zinc Efflux Pathway

The zntB locus of S. enterica serovar Typhimurium encodes a protein involved in the transmembrane flux of zinc . Mutations at zntB render the cell hypersensitive to the cytotoxic effects of zinc, suggesting ZntB plays a role in the efflux of this cation . ZntB mutations diminish the capacity to extrude Zn 2+ without significantly affecting the uptake activity . ZntB is not able to function as a Mg 2+ uptake pathway .

Research Findings

  • ZntB mediates zinc uptake: Stimulated by a pH gradient across the membrane, using a transport mechanism that does not resemble the one proposed for homologous CorA channels .

  • ZntB is a zinc importer: Driven by a proton gradient, with a transport mechanism distinct from that of CorA Mg2+ channels .

  • ZntB affects the transport of Zn2+ and Cd2+: Analysis of regulation of ZntB expression in C. metallidurans revealed that it was downregulated in the presence of high concentrations of Zn2+, Cd2+, and Cu2+ .

  • ZntB facilitates the efflux of zinc: Expression of ZntB from pAJW54 further increased the rate of 65Zn 2+ efflux .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
zntB; ECH74115_1990; Zinc transport protein ZntB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-327
Protein Length
full length protein
Species
Escherichia coli O157:H7 (strain EC4115 / EHEC)
Target Names
zntB
Target Protein Sequence
MEAIKGSDVNVPDAVFAWMLDGRGGVKPLENTDVIDEAHPCWLHLNYVHHDSAQWLATTP LLPNNVRDALAGESTRPRVSRLGEGTLITLRCINGSTDERPDQLVAMRVYMDGRLIVSTR QRKVLALDDVVSDLEEGTGPTDCGGWLVDVCDALTDHSSEFIEQLHDKIIDLEDNLLDQQ IPPRGFLALLRKQLIVMRRYMAPQRDVYARLASERLPWMSDDQRRRMQDIADRLGRGLDE IDACIARTGVMADEIAQVMQENLARRTYTMSLMAMVFLPSTFLTGLFGVNLGGIPGGGWQ FGFSIFCILLVVLIGGVALWLHRSKWL
Uniprot No.

Target Background

Function

Mediates the efflux of zinc ions.

Database Links
Protein Families
CorA metal ion transporter (MIT) (TC 1.A.35) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.