Recombinant Escherichia coli O157:H7 Zinc transporter ZupT (zupT)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization of Recombinant ZupT

Recombinant ZupT is a full-length, His-tagged protein expressed in E. coli for research applications. Key structural and technical specifications include:

ParameterDetails
Source OrganismEscherichia coli O157:H7 (strain EDL933)
UniProt IDB5YR85
Amino Acid Range1–257
TagN-terminal His tag
Expression SystemE. coli
FunctionHigh-affinity zinc uptake via ZIP (ZRT/IRT-like protein) transporter family

This construct enables biochemical studies, including metal-binding assays and structural analyses .

Functional Role in Zinc Homeostasis

ZupT operates as a secondary zinc transporter in E. coli O157:H7, complementing the primary ZnuABC system:

  • Transport Mechanism: Unlike ATP-dependent ZnuABC, ZupT relies on chemiosmotic gradients for zinc import .

  • Substrate Specificity: Transports Zn²⁺, Mn²⁺, and Fe²⁺, but with lower affinity for zinc compared to ZnuABC .

  • Redundancy: In zinc-limited conditions, ZupT partially compensates for ZnuABC loss, though double Δznu ΔzupT mutants show severe growth defects .

Pathogenicity and Host Interaction

ZupT contributes to E. coli O157:H7 virulence through indirect mechanisms:

  • Adhesion to Epithelial Cells:

    • znuA and zinT (a ZupT-associated periplasmic protein) are upregulated during epithelial cell adhesion .

    • ΔzupT mutants exhibit reduced motility, impairing colonization in murine urinary tract infection (UTI) models .

  • Oxidative Stress Resistance:

    • Zinc uptake via ZupT enhances bacterial survival under hydrogen peroxide stress .

    • Loss of ZupT reduces Fur regulator activity, increasing susceptibility to host immune responses .

Table 1: Comparative Studies of ZupT in E. coli Pathogens

StudyStrainKey Findings
Sabri et al. (2009) UPEC CFT073ΔzupT mutants show 30-fold reduction in bladder colonization in mice.
Ilari et al. (2011) E. coli O157:H7ZinT secretion induces zinc starvation in host cells, aiding bacterial adhesion.
Creative BioMart (2025) E. coli O157:H7Recombinant ZupT enables in vitro metal-binding assays and structural studies.

Critical Observations:

  • Zinc Scarcity in Host Niches: Human urine and intestinal mucosa limit zinc availability, necessitating ZupT/ZnuABC synergy for bacterial survival .

  • Regulatory Dynamics: Zur (zinc uptake regulator) represses zupT under zinc-replete conditions, but derepression occurs during infection .

Applications and Future Directions

Recombinant ZupT is pivotal for:

  • Drug Development: Targeting ZupT could disrupt zinc homeostasis in pathogenic E. coli .

  • Diagnostics: Detecting ZupT in clinical isolates may predict strain virulence .

  • Structural Biology: His-tagged ZupT facilitates crystallography to map metal-binding domains .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
zupT; ECH74115_4353; Zinc transporter ZupT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-257
Protein Length
full length protein
Species
Escherichia coli O157:H7 (strain EC4115 / EHEC)
Target Names
zupT
Target Protein Sequence
MSVPLILTILAGAATFIGAFLGVLGQKPSNRLLAFSLGFAAGIMLLISLMEMLPAALAAE GMSPVLGYGMFIFGLLGYFGLDRMLPHAHPQDLMQKSVQPLPKSIKRTAILLTLGISLHN FPEGIATFVTASSNLELGFGIALAVALHNIPEGLAVAGPVYAATGSKRTAILWAGISGLA EILGGVLAWLILGSMISPVVMAAIMAAVAGIMVALSVDELMPLAKEIDPNNNPSYGVLCG MSVMGFSLVLLQTAGIG
Uniprot No.

Target Background

Function
Mediates zinc uptake. May also transport other divalent cations.
Database Links
Protein Families
ZIP transporter (TC 2.A.5) family, ZupT subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is ZupT and how does it function in E. coli O157:H7?

ZupT is a member of the ZIP (ZRT IRT-like Proteins) family of transporters responsible for increasing intracellular zinc concentration in organisms ranging from E. coli to humans. In E. coli O157:H7, ZupT functions as a secondary zinc transporter that works alongside the primary ZnuACB transport system. Unlike ZnuACB, which uses ATP hydrolysis for transport, ZupT relies on a chemo-osmotic gradient to facilitate metal ion movement across the bacterial membrane . The protein has broader substrate specificity than ZnuACB, capable of mediating uptake of not only Zn²⁺ but also Mn²⁺ and Fe²⁺, making it a versatile component of bacterial metal homeostasis machinery .

How does the structure of ZupT relate to its transport function?

ZupT possesses a distinctive binuclear metal transport center, which is relatively uncommon among metal transporters. Based on homology modeling with a ZIP transporter from B. bronchiseptica (32% identity), the ZupT structure reveals two metal binding sites separated by approximately 4.2 Å . The primary site (site 1) coordinates metal ions through His148, Glu152, and a bidentate Glu123, while the secondary site (site 2) involves Asn120, Asn149, and Glu181 . This structural arrangement supports ZupT's ability to bind both zinc and iron, though with different stoichiometries - binding one equivalent of zinc (its primary substrate) at physiological concentrations while accommodating two equivalents of iron .

How can recombinant ZupT from E. coli O157:H7 be effectively expressed and purified?

Expression and purification of recombinant ZupT presents challenges common to membrane proteins. Based on current methodologies, a recommended approach includes:

  • Expression system design: Clone the zupT gene into a pET expression vector (such as pET-24a+) with a C-terminal His-tag for purification .

  • Host selection: Transform E. coli BL21(DE3) cells, which lack proteases that might degrade the recombinant protein .

  • Expression optimization: Culture transformed cells in LB medium supplemented with appropriate antibiotics until mid-log phase (OD₆₀₀ ≈ 0.6-0.8), then induce expression with 1mM IPTG .

  • Membrane extraction: Harvest cells, disrupt by sonication, and separate membrane fractions by ultracentrifugation.

  • Protein solubilization: Solubilize membrane proteins using mild detergents such as n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucopyranoside (OG).

  • Affinity purification: Perform nickel affinity chromatography, utilizing the His-tag, with imidazole gradient elution to obtain purified ZupT .

  • Quality assessment: Analyze purification success using SDS-PAGE and Western blotting with anti-His antibodies.

This methodology has been successfully applied to ZupT and similar membrane transporters, though yields may be lower than for soluble proteins due to inherent challenges in membrane protein expression.

What methods are most effective for measuring ZupT-mediated zinc transport activity?

Several complementary approaches can be employed to assess ZupT transport activity:

The combination of these approaches provides comprehensive insights into ZupT transport kinetics, selectivity, and structure-function relationships.

How does iron binding influence ZupT-mediated zinc transport in E. coli O157:H7?

Recent research has uncovered an intriguing regulatory relationship between iron and zinc transport through ZupT. While ZupT primarily functions as a zinc transporter, it demonstrates the ability to bind iron at two distinct sites, compared to just one binding site for zinc . Solution studies with purified ZupT have revealed that iron positively regulates zinc activity, suggesting an allosteric interaction between these metal binding events .

The molecular mechanism behind this positive regulation likely involves:

  • Iron binding to the secondary site (site 2) inducing conformational changes that enhance zinc binding affinity at the primary site (site 1).

  • Alterations in the transport channel dynamics when both metals are present, potentially increasing the rate of zinc translocation.

  • Modulation of proton coupling or other energetic aspects of transport when both metals interact with the transporter.

This iron-zinc interplay may represent an adaptive mechanism allowing bacteria to coordinate the uptake of different essential metals based on their relative environmental availability. For researchers, this finding highlights the importance of considering metal cross-talk when designing experiments to characterize ZupT function or when developing strategies to impair metal acquisition by pathogenic E. coli strains.

What roles do specific amino acid residues play in ZupT's metal selectivity and transport mechanism?

Structure-function analysis of ZupT has identified key residues that contribute to its metal transport capabilities. Through site-directed mutagenesis and functional assays, researchers have determined that:

The relative conservation of these residues across ZIP family transporters suggests fundamental mechanistic similarities, despite the diverse metal preferences observed among family members. Future research directions should include characterizing the protonation states of these residues during the transport cycle and identifying additional residues involved in conformational changes associated with transport.

How does ZupT contribute to E. coli O157:H7 virulence and pathogenesis?

The contribution of ZupT to E. coli O157:H7 virulence involves several interconnected mechanisms:

  • Nutritional immunity evasion: During infection, host organisms sequester essential metals like zinc as an innate defense mechanism (nutritional immunity). ZupT helps E. coli O157:H7 overcome this restriction by providing a secondary zinc acquisition pathway .

  • Colonization support: The zinc import apparatus, including ZupT, facilitates bacterial adhesion to epithelial cells, a critical initial step in intestinal colonization. Mutants lacking functional zinc transporters demonstrate reduced adhesion capabilities in cell culture models .

  • Oxidative stress resistance: ZupT contributes to bacterial defense against oxidative stress, as zinc transporter-deficient strains show decreased resistance to hydrogen peroxide. This protection is restored by zinc supplementation, highlighting the metal's role in oxidative stress response pathways .

  • Motility maintenance: Zinc transport systems support bacterial motility, which is essential for initial colonization and dissemination within the host. Loss of ZupT and ZnuACB results in reduced motility that can be restored with zinc supplementation .

In competitive infection models using CBA/J mice, ZupT mutants show colonization defects compared to wild-type strains, with combined ZnuACB-ZupT mutants displaying the most significant attenuation . These findings underscore the potential of zinc transport systems as targets for developing new preventive and therapeutic strategies against E. coli O157:H7 infections.

How can understanding ZupT function inform vaccine development against E. coli O157:H7?

The critical role of zinc transporters in E. coli O157:H7 pathogenesis presents promising opportunities for vaccine development:

  • Attenuated live vaccine potential: ΔznuΔzupT double mutants, with their significantly impaired virulence while maintaining immunogenicity, could serve as candidate attenuated live vaccine strains .

  • Subunit vaccine approaches: Recombinant ZupT, particularly immunogenic extracellular loops or domains, could be incorporated into subunit vaccine formulations. This approach is conceptually similar to the chimeric protein vaccine candidate that incorporated outer membrane protein A (OmpA) and B subunit of E. coli heat labile enterotoxin (LTB) .

  • Adjuvant properties: The immunomodulatory effects of zinc deficiency could be leveraged to enhance vaccine responses, potentially by timing vaccination with controlled zinc supplementation.

  • Combination strategies: Since prevention is considered more effective than treatment for E. coli O157:H7 (as antibiotic therapy increases the risk of hemolytic uremic syndrome), targeting multiple virulence factors including zinc acquisition systems may provide more robust protection .

The development of such vaccines would require careful assessment of cross-protection against diverse E. coli strains, durability of immune response, and potential side effects related to disrupting normal zinc homeostasis in commensal bacteria.

What are the implications of ZupT's broader metal specificity for bacterial physiology and pathogenesis?

ZupT's ability to transport multiple metal ions (Zn²⁺, Fe²⁺, Mn²⁺) has significant implications for bacterial physiology and virulence:

Future research should explore these relationships through transcriptomic and proteomic approaches comparing wild-type and zinc transporter mutants under various metal availability conditions, potentially revealing new targets for antimicrobial intervention.

How can site-directed mutagenesis of ZupT inform the development of inhibitors targeting zinc acquisition?

The detailed understanding of ZupT's structure and function through site-directed mutagenesis provides valuable insights for developing targeted inhibitors:

  • Critical residue targeting: Mutagenesis studies have identified His148, Glu152, and Glu123 as critical for zinc binding and transport. Small molecule inhibitors designed to interact with these specific residues could selectively impair ZupT function .

  • Allosteric site exploitation: The identification of His119 as important for transport activity but not directly involved in metal binding suggests the existence of allosteric regulatory sites that could be targeted by inhibitors .

  • Metal mimetics: Based on the understanding of ZupT's metal coordination chemistry, non-transportable metal mimetics could be developed that bind tightly to the transporter without being transported, effectively blocking zinc uptake.

  • Dual-targeting strategies: Since ZnuACB is the predominant zinc transporter, with ZupT playing a secondary role, maximum efficacy would likely require targeting both systems. Structure-guided approaches could identify inhibitors that interact with conserved features across these transporters .

  • Synergistic approaches: Combining zinc transport inhibitors with strategies that increase oxidative stress could be particularly effective, given the role of zinc in protecting against oxidative damage .

The development pathway for such inhibitors would involve initial in silico screening based on the ZupT structural model, followed by biochemical validation with purified protein, and ultimately testing in cellular and animal infection models.

What are the key challenges in expressing and characterizing membrane transporters like ZupT?

Researchers face several significant challenges when working with ZupT and similar membrane transporters:

  • Expression limitations: Membrane proteins often express at lower levels than soluble proteins and can be toxic to host cells when overexpressed. Optimizing expression conditions, including temperature, inducer concentration, and expression duration, is critical .

  • Solubilization complexities: Extracting membrane proteins requires careful selection of detergents that maintain native structure and function. Different detergents may be optimal for different experimental applications (e.g., structural studies versus activity assays) .

  • Functional reconstitution: Assessing transport activity often requires reconstitution into artificial membrane systems like liposomes, which adds technical complexity compared to soluble enzyme assays.

  • Structural characterization: Obtaining high-resolution structural information remains challenging for membrane transporters, though advances in cryo-electron microscopy are improving accessibility.

  • Physiologically relevant metal concentrations: Studying zinc transport is complicated by the extremely low free zinc concentrations in biological systems and the technical challenges of controlling metal availability in experimental settings.

Researchers have addressed these challenges through approaches such as:

  • Using tightly controlled expression systems with lower copy number plasmids

  • Exploration of membrane mimetics beyond traditional detergents, including nanodiscs and styrene-maleic acid copolymer lipid particles (SMALPs)

  • Development of real-time metal transport assays with improved sensitivity

How does ZupT function differ between pathogenic E. coli O157:H7 and non-pathogenic E. coli strains?

Comparative analysis of ZupT function reveals both similarities and differences between pathogenic E. coli O157:H7 and non-pathogenic strains like E. coli K-12:

CharacteristicE. coli O157:H7 ZupTE. coli K-12 ZupT
Primary structureHighly conserved ZIP family transporterHighly conserved ZIP family transporter
Metal specificityTransports Zn²⁺, Fe²⁺, Mn²⁺Transports Zn²⁺, Fe²⁺, Mn²⁺
Contribution to growth in Zn-limited mediaSecondary to ZnuACBSecondary to ZnuACB
⁶⁵Zn²⁺ uptake in ΔzupT mutantModest decrease compared to wild-typeModest decrease compared to wild-type
Virulence impactContributes to colonization and infectionNot applicable (non-pathogenic)
RegulationZur-independentZur-independent
Interaction with ZinTLimited functional interactionLimited functional interaction

Despite the high conservation of ZupT across E. coli strains, its contribution to pathogenesis appears to be strain-specific, with more significant roles in pathogenic contexts . Additionally, the precise regulation of ZupT expression may differ between pathogenic and non-pathogenic strains, potentially reflecting adaptation to different ecological niches with varying zinc availability.

What is the relative contribution of ZupT compared to ZnuACB in zinc acquisition under different environmental conditions?

The relative importance of ZupT versus ZnuACB varies significantly depending on environmental conditions:

  • Severe zinc limitation: Under conditions of extreme zinc scarcity, ZnuACB dominates zinc acquisition due to its higher affinity. ΔznuA mutants show significantly impaired growth in zinc-depleted media, while ΔzupT mutants show less severe defects .

  • Moderate zinc availability: When zinc is present at low but not extreme levels, both systems contribute to zinc uptake, with ΔznuΔzupT double mutants showing more severe growth defects than either single mutant .

  • Host infection environments: During infection, ZnuACB plays a more critical role than ZupT in overcoming host nutritional immunity. In murine UTI models, ΔznuA mutants showed 4.4-fold reduction in bladder colonization and 41-fold reduction in kidney colonization, while ΔzupT mutants showed no significant disadvantage .

  • Oxidative stress conditions: Both transport systems contribute to oxidative stress resistance, with double mutants showing the greatest sensitivity to hydrogen peroxide. This suggests complementary roles during oxidative stress exposure .

  • Iron-rich environments: Given that iron positively regulates ZupT-mediated zinc transport, ZupT may play a more significant role in zinc acquisition when iron is abundant .

The differential contribution likely reflects the distinct biochemical properties of these transporters - ZnuACB being a high-affinity, ATP-dependent system optimized for scavenging trace zinc, while ZupT offers broader specificity at the cost of lower zinc affinity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.