Recombinant Escherichia coli O17:K52:H18 4-hydroxybenzoate octaprenyltransferase (ubiA)

Shipped with Ice Packs
In Stock

Description

Enzymatic Activity and Mechanism

UbiA catalyzes the transfer of an octaprenyl group from octaprenyl pyrophosphate (OPP) to 4-hydroxybenzoate (4-HB), forming 3-octaprenyl-4-hydroxybenzoate—a key intermediate in ubiquinone-8 biosynthesis . Key mechanistic insights:

  • Substrate Specificity: Broad specificity for polyprenyl pyrophosphates (C20–C50), though primarily utilizes OPP (C40) in E. coli .

  • Cofactor Requirement: Mg²⁺ is essential for optimal activity .

  • Catalytic Steps:

    1. Cleavage of OPP’s diphosphate group generates a reactive carbocation intermediate.

    2. Prenyl group transfer to the meta-position of 4-HB forms a C–C bond .

Mutant studies (e.g., ubiA⁻ strains) confirm the enzyme’s indispensability: Complementation with yeast COQ2 restores ubiquinone production, demonstrating functional homology across species .

Genetic and Functional Studies

  • Gene Localization: The ubiA gene maps to minute 79 on the E. coli chromosome .

  • Regulation: Expression is catabolite-repressed by glucose, particularly in arcA mutants, linking UbiA to oxygen-regulated metabolic pathways .

  • Membrane Association: Both UbiA and its polyprenyl substrate are membrane-bound, necessitating detergent extraction for in vitro assays .

Biotechnological Relevance

  • Heterologous Expression: Recombinant UbiA is produced in E. coli with high yield (~1 mg/mL post-purification), enabling large-scale studies .

  • Structural Biology: Serves as a model for UbiA superfamily enzymes, aiding in inhibitor design for pathogens reliant on ubiquinone (e.g., Mycobacterium tuberculosis) .

Comparative Analysis with Homologs

FeatureE. coli UbiAS. cerevisiae COQ2Human COQ2
Prenyl ChainOctaprenyl (C40)Hexaprenyl (C30)Decaprenyl (C50)
Substrate FlexibilityBroad (C20–C50 accepted)BroadNarrow (specific to C50)
Disease LinkNoneInfantile multisystem disease CoQ10 deficiency syndromes

Challenges and Future Directions

While recombinant UbiA is stable and active in vitro, its membrane-bound nature complicates crystallization efforts . Advances in detergent-free purification and cryo-EM could resolve its structure, further elucidating substrate recognition mechanisms.

This enzyme’s promiscuity in chain-length acceptance also positions it as a candidate for engineered biosynthesis of non-natural quinones .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, should you have a specific format preference, please indicate it in your order notes. We will fulfill your request based on availability.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery estimates, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
ubiA; ECUMN_4574; 4-hydroxybenzoate octaprenyltransferase; 4-HB polyprenyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Target Names
ubiA
Target Protein Sequence
MEWSLTQNKLLAFHRLMRTDKPIGALLLLWPTLWALWVATPGVPQLWILAVFVAGVWLMR AAGCVVNDYADRKFDGHVKRTANRPLPSGAVTEKEARALFVVLVLISFLLVLTLNTMTIL LSIAALALAWVYPFMKRYTHLPQVVLGAAFGWSIPMAFAAVSESVPLSCWLMFLANILWA VAYDTQYAMVDRDDDVKIGIKSTAILFGQYDKLIIGILQIGVLALMAIIGELNGLGWGYY WSILVAGALFVYQQKLIANREREACFKAFMNNNYVGLVLFLGLAMSYWHF
Uniprot No.

Target Background

Function
This enzyme catalyzes the prenylation of para-hydroxybenzoate (PHB) with an all-trans polyprenyl group. It mediates the second step in the final reaction sequence of ubiquinone-8 (UQ-8) biosynthesis. This step involves the condensation of the polyisoprenoid side chain with PHB, generating the first membrane-bound Q intermediate, 3-octaprenyl-4-hydroxybenzoate.
Database Links
Protein Families
UbiA prenyltransferase family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the genetic and functional significance of the ubiA gene in Escherichia coli?

The ubiA gene in Escherichia coli encodes 4-hydroxybenzoate octaprenyltransferase, a critical enzyme in the ubiquinone biosynthesis pathway. Genetic analysis has mapped the ubiA gene to minute 79 on the E. coli chromosome map . This enzyme catalyzes the conversion of 4-hydroxybenzoate into 3-octaprenyl-4-hydroxybenzoate, a fundamental step in ubiquinone synthesis. Studies with ubiA(-) mutants have conclusively demonstrated that these mutants lack 4-hydroxybenzoate octaprenyltransferase activity, confirming that ubiA is indeed the structural gene coding for this enzyme . This finding is significant because it establishes the direct genetic-functional relationship between the ubiA gene and the enzyme it encodes, providing a clear target for genetic manipulation in recombinant studies.

What are the basic characteristics of 4-hydroxybenzoate octaprenyltransferase in E. coli?

4-Hydroxybenzoate octaprenyltransferase in E. coli is a membrane-bound enzyme that catalyzes a critical step in ubiquinone biosynthesis . Research has demonstrated that both the enzyme and its substrate (the side-chain precursor) are localized in the bacterial membrane . Biochemical characterization has revealed that the enzyme requires magnesium ions (Mg²⁺) for optimal catalytic activity . This enzyme specificity is important when designing experimental protocols for enzyme activity assays or recombinant expression systems. The membrane-bound nature of this enzyme presents particular challenges for purification and in vitro studies, requiring appropriate detergent-based extraction methods. Understanding these basic characteristics is essential for researchers planning to work with this enzyme in recombinant systems or for studying ubiquinone biosynthesis pathways.

What are the optimal conditions for expressing recombinant 4-hydroxybenzoate octaprenyltransferase in E. coli?

For optimal expression of recombinant 4-hydroxybenzoate octaprenyltransferase in E. coli, researchers should consider several critical factors. Based on the enzyme's membrane-bound nature , expression systems should incorporate appropriate membrane-targeting signals. The use of expression plasmids such as pBAD24 has been successfully implemented for similar membrane proteins. Since the enzyme requires Mg²⁺ for optimal activity , supplementation of growth media with magnesium salts (typically 5-10 mM MgCl₂) is advisable. Expression should be conducted in E. coli strains that are deficient in endogenous ubiA activity (ubiA- mutants) to prevent interference with recombinant enzyme characterization. For induction, researchers have successfully used arabinose-inducible promoters with induction at mid-logarithmic phase (OD₆₀₀ of 0.6-0.8) at 30°C rather than 37°C to enhance proper membrane protein folding. Extraction and purification protocols must account for the membrane-bound nature of the enzyme, typically requiring detergents like n-dodecyl-β-D-maltoside (DDM) at 1-2% for solubilization followed by affinity chromatography using polyhistidine tags.

How can researchers effectively measure 4-hydroxybenzoate octaprenyltransferase activity in experimental settings?

Measuring 4-hydroxybenzoate octaprenyltransferase activity requires specialized approaches due to the enzyme's membrane association and specific substrate requirements. A validated methodology involves preparing membrane fractions from E. coli cells through differential centrifugation, followed by enzyme activity assays in buffer systems containing 50 mM Tris-HCl (pH 7.5), 5 mM MgCl₂, and appropriate detergents at concentrations below their critical micelle concentration . The reaction mixture should contain 4-hydroxybenzoate as substrate and the octaprenyl pyrophosphate side-chain precursor. Activity can be monitored by quantifying the formation of 3-octaprenyl-4-hydroxybenzoate using HPLC with UV detection at 246-250 nm. Alternatively, radiometric assays using ¹⁴C-labeled 4-hydroxybenzoate allow for more sensitive detection. When working with recombinant systems, researchers should implement proper controls using known ubiA(-) mutants to validate assay specificity. Kinetic parameters can be determined by varying substrate concentrations, with reported Km values for 4-hydroxybenzoate typically in the low micromolar range. For in vivo activity assessment, complementation studies in ubiA-deficient strains analyzing restoration of ubiquinone production provide functional validation.

What genetic engineering strategies are most effective for modifying ubiA in Escherichia coli?

Genetic engineering of the ubiA gene in E. coli can be approached through several sophisticated strategies. Site-directed mutagenesis remains a powerful technique for introducing specific amino acid substitutions to investigate structure-function relationships, particularly targeting conserved motifs involved in substrate binding or catalysis. The plasmid-based expression systems utilizing vectors like pBAD24 or pKO3 have proven effective for controlled expression of modified ubiA variants. For chromosomal modifications, CRISPR-Cas9-based genome editing offers precise alteration of the native ubiA locus without leaving marker genes. Lambda Red recombineering provides an alternative approach for generating clean deletions or insertions. When designing ubiA variants, researchers should consider the membrane topology of the enzyme and maintain critical transmembrane domains. Transcriptional fusions using GFP facilitate monitoring of expression levels and localization patterns. For functional validation of engineered variants, complementation studies in ubiA(-) mutants are essential, assessing restoration of ubiquinone synthesis and respiratory competence. When engineering ubiA for enhanced activity or altered substrate specificity, directed evolution approaches employing error-prone PCR followed by selection on respiratory substrates have proven effective for identifying beneficial mutations that might not be predicted through rational design.

What analytical techniques are most appropriate for studying the structure and function of 4-hydroxybenzoate octaprenyltransferase?

A multi-faceted analytical approach is necessary for comprehensive characterization of 4-hydroxybenzoate octaprenyltransferase structure and function. For structural analysis, cryo-electron microscopy has emerged as the preferred technique for membrane proteins, avoiding the challenges of crystallization required for X-ray crystallography. Hydrogen-deuterium exchange mass spectrometry (HDX-MS) provides valuable insights into protein dynamics and ligand interactions without requiring crystallization. Circular dichroism spectroscopy can determine secondary structure content and thermal stability profiles. For functional characterization, enzyme kinetics should be assessed using HPLC-based assays monitoring product formation, while isothermal titration calorimetry enables precise determination of binding affinities for substrates and inhibitors. Site-directed mutagenesis coupled with activity assays remains essential for identifying critical catalytic residues. Advanced approaches include nanodiscs technology for reconstituting the enzyme in a native-like membrane environment, improving biochemical characterization accuracy. Molecular dynamics simulations can model substrate binding and catalytic mechanisms, particularly useful when working with membrane proteins where experimental structures are challenging to obtain. For in vivo functional assessment, metabolic profiling of ubiquinone and intermediates using LC-MS/MS in wild-type versus ubiA mutant strains provides physiologically relevant functional data.

How can researchers effectively design studies to investigate the role of ubiA in E. coli pathogenicity?

Designing rigorous studies to investigate ubiA's role in E. coli pathogenicity requires a multi-dimensional approach. Researchers should first establish isogenic ubiA deletion mutants in reference pathogenic strains such as uropathogenic E. coli O15:K52:H1 , using scarless genome editing techniques to avoid polar effects. Complementation strains carrying wild-type ubiA on controlled-expression plasmids are essential controls. Phenotypic characterization should assess growth in aerobic versus anaerobic conditions and in media mimicking host environments. Virulence factor expression analysis should examine whether ubiA deletion affects known pathogenicity determinants such as papG allele II and papA allele F16 . In vitro infection models using relevant cell lines (uroepithelial cells for uropathogenic strains) can evaluate adherence, invasion, and intracellular persistence capabilities. For in vivo relevance, established animal models such as the mouse UTI model for uropathogenic strains or gut colonization models should be employed, comparing wild-type, mutant, and complemented strains. Competitive index assays, where mutant and wild-type strains compete in the same animal, provide sensitive measures of fitness defects. Transcriptomic and metabolomic analyses comparing wild-type and ubiA mutants under infection-relevant conditions can reveal how ubiquinone deficiency affects global gene expression and metabolic adaptation during infection. Finally, researchers should investigate the impact of ubiA deletion on antibiotic susceptibility profiles, as pathogenic strains like O15:K52:H1 exhibit extensive antimicrobial resistance capabilities .

What are common challenges in working with recombinant 4-hydroxybenzoate octaprenyltransferase and how can they be addressed?

Researchers working with recombinant 4-hydroxybenzoate octaprenyltransferase commonly encounter several technical challenges. First, being a membrane-bound enzyme , it often exhibits low expression levels and forms inclusion bodies. This can be addressed by using lower induction temperatures (16-25°C), specialized E. coli strains designed for membrane protein expression (C41/C43), and fusion tags that enhance solubility. Second, enzyme activity may be compromised during purification due to detergent-mediated disruption of the native membrane environment. Researchers should screen multiple detergents (DDM, LDAO, Triton X-100) at various concentrations to identify optimal solubilization conditions that preserve activity. Third, the octaprenyl substrate is highly hydrophobic and may have limited solubility in aqueous assay systems. This can be overcome by using appropriate detergent concentrations below CMC or phospholipid-based reconstitution systems. Fourth, researchers often encounter difficulties in distinguishing recombinant enzyme activity from endogenous E. coli enzyme. Using ubiA knockout strains as expression hosts eliminates this background activity . Fifth, enzyme instability during storage can be mitigated by adding glycerol (20-25%) and reducing agents like DTT (1-5 mM) to purified enzyme preparations. For activity assays, inconsistent results often stem from batch-to-batch variation in substrate quality; using freshly prepared or commercial high-purity reagents improves reproducibility. When conducting kinetic studies, biphasic enzyme kinetics may be observed due to substrate partitioning in micelles, necessitating careful data interpretation and appropriate mathematical models.

How should researchers interpret contradictory data regarding ubiA function in different experimental systems?

When confronted with contradictory data regarding ubiA function across different experimental systems, researchers should implement a systematic analytical framework. First, carefully examine the genetic backgrounds of the E. coli strains used, as strain-specific genetic variations may influence ubiA function. Research indicates that even within the same serotype like O15:K52:H1, strains can exhibit different antimicrobial resistance profiles despite sharing common virulence factors . Second, assess whether experiments were conducted under aerobic versus anaerobic conditions, as E. coli possesses both oxygen-dependent and oxygen-independent pathways for ubiquinone synthesis . The recently characterized UbiUVT complex enables O₂-independent ubiquinone synthesis and may compensate for ubiA deficiencies under anaerobic conditions . Third, evaluate the specific assay systems employed, as membrane-bound enzyme activity is highly dependent on the membrane environment and detergent conditions used during purification and assay setup . Fourth, consider the possibility of post-translational modifications or protein-protein interactions that may differ between in vivo and in vitro systems. Fifth, examine whether contradictions stem from different substrate concentrations or the presence of inhibitory compounds. Finally, researchers should design targeted experiments to directly address contradictions, ideally conducting head-to-head comparisons using standardized conditions and multiple complementary techniques. When reporting such findings, a comprehensive discussion of experimental parameters is essential to reconcile apparent contradictions and advance understanding of this complex enzymatic system.

What statistical approaches are most appropriate for analyzing data from ubiA expression and functional studies?

Selecting appropriate statistical approaches for ubiA studies requires consideration of specific experimental designs and data characteristics. For gene expression analysis using qPCR or RNA-seq, normalization should employ multiple reference genes validated for stability under experimental conditions, with ANOVA or linear mixed-effects models for comparisons across multiple conditions. When analyzing enzyme kinetic data, non-linear regression using Michaelis-Menten or appropriate allosteric models should be employed with confidence intervals reported for all parameters (Km, Vmax). For membrane protein studies, researchers should be particularly attentive to outliers that may result from aggregation or detergent effects; robust regression methods may be more appropriate than standard least-squares approaches. In growth phenotype analyses comparing wild-type versus ubiA mutant strains, repeated measures ANOVA or growth curve fitting approaches (such as Gompertz or logistic models) provide more informative analysis than single time-point comparisons. For in vivo colonization or infection studies, non-parametric tests (Mann-Whitney U) are often more appropriate due to typically non-normal distributions of bacterial counts. Power analysis should be conducted a priori to determine appropriate sample sizes, particularly for animal studies. When integrating multiple data types (transcriptomic, metabolomic, phenotypic), multivariate approaches such as principal component analysis or partial least squares discrimination analysis help identify patterns and correlations across datasets. For all analyses, effect sizes should be reported alongside p-values to indicate biological significance. Researchers should also consider applying false discovery rate correction when conducting multiple comparisons, particularly in omics-level studies where hundreds of comparisons may be made simultaneously.

What emerging technologies might enhance our understanding of ubiA function and regulation?

Several cutting-edge technologies hold promise for advancing our understanding of ubiA function and regulation. CRISPR interference (CRISPRi) and CRISPR activation (CRISPRa) systems allow for precise temporal control of ubiA expression without permanent genetic modifications, enabling studies of dose-dependent effects and regulation dynamics. Single-cell technologies including microfluidics combined with fluorescent reporters can reveal cell-to-cell variability in ubiA expression and ubiquinone production, potentially uncovering stochastic regulation mechanisms. Cryo-electron tomography offers unprecedented opportunities to visualize the native membrane environment of 4-hydroxybenzoate octaprenyltransferase in situ, providing insights into its spatial organization and potential interactions with other membrane components. AlphaFold2 and similar AI-based structural prediction tools can generate highly accurate structural models of the enzyme, particularly valuable given the challenges of membrane protein crystallization. Time-resolved mass spectrometry approaches enable tracking of ubiquinone biosynthesis intermediates with millisecond resolution, allowing detailed kinetic mapping of the pathway. Biosensors for real-time monitoring of ubiquinone levels in living cells would transform our ability to study regulation under dynamic conditions. RNA structurome analysis can identify potential regulatory RNA structures affecting ubiA expression. ChIP-sequencing applied to known regulators like Fnr across different oxygen conditions would comprehensively map the regulatory network controlling ubiA expression. Finally, bacterial cytological profiling combined with high-content imaging could reveal the broader cellular consequences of ubiA perturbation, linking it to other cellular processes and stress responses.

How might comparative genomics approaches enhance understanding of ubiA evolution and function across bacterial species?

Comparative genomics approaches offer powerful frameworks for elucidating ubiA evolution and function across diverse bacterial species. By constructing comprehensive phylogenetic trees of ubiA homologs across bacterial phyla, researchers can identify lineage-specific adaptations and conservation patterns that inform functional constraints. Synteny analysis—examining gene order conservation around ubiA—can reveal operon structures and potentially co-evolved gene clusters involved in ubiquinone biosynthesis. Positive selection analysis using dN/dS ratios across aligned sequences can identify specific amino acid residues under evolutionary pressure, highlighting functionally critical regions. The integration of structural predictions with evolutionary conservation data using approaches like evolutionary trace analysis can map conserved motifs onto three-dimensional structures, revealing surface patches likely involved in substrate binding or catalysis. Horizontal gene transfer events can be detected through anomalous GC content, codon usage bias, or phylogenetic incongruence, potentially explaining ubiA distribution patterns in certain bacterial clades. Genome-wide association studies across E. coli strains with phenotyped ubiquinone production capacities could identify genetic modifiers of ubiA function. Comparative analysis of transcriptional regulatory regions can identify conserved binding sites for regulators like Fnr and strain-specific regulatory mechanisms. The systematic comparison of ubiA genes from pathogenic versus non-pathogenic E. coli strains, like the extensively studied O15:K52:H1 , might reveal adaptations supporting pathogenicity. Finally, pan-genome analysis across multiple E. coli isolates would establish whether ubiA belongs to the core or accessory genome, informing its essentiality and potential as a therapeutic target.

What are the implications of ubiA research for developing new antimicrobial strategies against pathogenic E. coli strains?

Research on ubiA offers several promising avenues for novel antimicrobial development against pathogenic E. coli strains. Since ubiquinone is essential for respiratory function, targeting ubiA could disrupt energy production in pathogens. The structural differences between bacterial 4-hydroxybenzoate octaprenyltransferase and its human counterpart create opportunities for developing selective inhibitors with minimal host toxicity. The recently characterized oxygen-independent ubiquinone biosynthesis pathway involving UbiUVT presents additional targets that could be particularly effective against pathogens in anaerobic infection sites like abscesses. Structure-based drug design approaches, informed by functional domains identified through mutational studies, could yield competitive inhibitors that block substrate binding. High-throughput screening for small molecule inhibitors of 4-hydroxybenzoate octaprenyltransferase activity represents a direct path to identifying lead compounds. The observed synergy between ubiquinone biosynthesis and antibiotic resistance in pathogenic strains like O15:K52:H1 suggests that ubiA inhibitors could potentially sensitize resistant pathogens to existing antibiotics, offering combination therapy possibilities. Antisense RNA or peptide nucleic acid strategies targeting ubiA mRNA could provide highly specific inhibition approaches. Live biotherapeutic products based on engineered probiotics that produce ubiA inhibitors locally in the gut could offer targeted intervention against pathogens while sparing beneficial microbiota. Considering the role of ubiquinone in handling oxidative stress, ubiA inhibitors might be particularly effective when combined with antibiotics that induce reactive oxygen species. Finally, vaccines targeting surface-exposed regions of membrane proteins involved in ubiquinone biosynthesis pathways could provide preventative options against pathogenic E. coli strains with concerning resistance profiles.

What are the optimal approaches for isolating high-quality functional 4-hydroxybenzoate octaprenyltransferase from recombinant E. coli?

Isolating functional 4-hydroxybenzoate octaprenyltransferase from recombinant E. coli requires specialized protocols that preserve the native structure and activity of this membrane-bound enzyme . The optimization process should begin with expression in E. coli strains specifically engineered for membrane protein production, such as C41(DE3) or Lemo21(DE3), using a moderate induction protocol (0.1-0.2 mM IPTG or 0.002% arabinose) at reduced temperature (20-25°C). Cell disruption should be performed using gentle methods such as osmotic shock or enzymatic lysis rather than sonication, which can damage membrane proteins. Membrane fraction isolation requires differential ultracentrifugation (typically 100,000 × g for 1 hour) following low-speed centrifugation to remove unbroken cells and debris. For solubilization, a screen of detergents is essential, with n-dodecyl-β-D-maltoside (DDM) at 1-1.5% and digitonin at 1% showing good results for similar membrane proteins. The critical solubilization parameters include detergent:protein ratio (typically 4:1), temperature (4°C), and duration (1-2 hours with gentle rotation). Purification is optimally achieved using affinity chromatography with polyhistidine tags positioned at the C-terminus to minimize interference with membrane insertion. Throughout purification, buffers should maintain conditions identified in biochemical studies: pH 7.5, 5 mM MgCl₂ , 150 mM NaCl, 10% glycerol, and detergent at approximately 2-3× critical micelle concentration. For long-term stability, incorporating lipids such as E. coli polar lipid extract (0.1-0.2 mg/ml) into purification buffers helps maintain the native environment. Following purification, reconstitution into nanodiscs or proteoliposomes using E. coli lipids provides a near-native membrane environment that significantly enhances enzyme stability and activity compared to detergent micelles.

What controls and validation steps are essential when studying recombinant 4-hydroxybenzoate octaprenyltransferase?

A rigorous validation pipeline is essential when working with recombinant 4-hydroxybenzoate octaprenyltransferase to ensure meaningful results. First, expression vectors should be sequence-verified, particularly at fusion junctions and throughout the ubiA coding sequence, to confirm the absence of mutations that might affect function. Protein expression should be verified using western blot analysis with antibodies against both the target protein and any fusion tags. Importantly, researchers must confirm proper membrane localization using membrane fractionation followed by western blotting or fluorescence microscopy if using fluorescent protein fusions. Functional validation requires complementation assays in ubiA(-) mutants , demonstrating restoration of ubiquinone synthesis and respiratory growth. For enzymatic activity, researchers must include several critical controls: (1) heat-inactivated enzyme preparations to establish baseline values, (2) assays using membranes from non-transformed host cells to account for any residual endogenous activity, (3) substrate specificity controls using structurally related compounds to confirm enzyme selectivity, and (4) assays with varying Mg²⁺ concentrations to verify the previously established cofactor requirement . When measuring kinetic parameters, researchers should verify that reactions proceed linearly with time and protein concentration under the conditions used. For structural studies, circular dichroism spectroscopy can confirm proper folding by comparing spectra with those of native enzyme. Finally, researchers should validate the purity of their enzyme preparation using size-exclusion chromatography coupled with multi-angle light scattering to detect potential aggregation or oligomerization, which can significantly impact functional assays.

How can researchers effectively design ubiA mutation studies to correlate sequence with function?

Designing effective ubiA mutation studies requires a strategic approach that maximizes functional insights. Researchers should begin with comprehensive sequence alignment of ubiA homologs across diverse bacterial species to identify highly conserved residues as primary targets for mutagenesis. Structural prediction using tools like AlphaFold2, informed by the membrane-bound nature of the enzyme , can identify potential substrate-binding regions and catalytic sites for targeted mutation. Rather than arbitrary mutations, researchers should implement a rational design approach focusing on: (1) predicted substrate-binding residues, (2) potential catalytic residues, (3) conserved regions near the active site, and (4) the Mg²⁺-binding motif given the established cofactor requirement . When designing mutations, conservative substitutions (e.g., Asp to Glu) should be tested alongside non-conservative ones (e.g., Asp to Ala) to distinguish between residues critical for structure versus function. For transmembrane regions, hydrophobicity-preserving mutations are essential to maintain proper membrane insertion. Beyond single-point mutations, researchers should consider domain swapping with homologous enzymes to identify regions conferring substrate specificity, particularly valuable for comparing prenyl transferases with different chain-length specificities. All mutant constructs should be validated by sequencing and expression level verification to ensure comparable protein levels. Functional characterization should include complementation assays in ubiA(-) mutants , detailed kinetic analysis measuring both Km and kcat parameters for substrates, and thermal stability assessments to distinguish catalytic defects from stability issues. For high-throughput approaches, deep mutational scanning coupled with selection for respiratory growth provides a comprehensive map of permissible substitutions. Data analysis should incorporate structural context by mapping mutation effects onto 3D models, facilitating the development of a structure-function relationship model for this important enzyme.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.