Recombinant Escherichia coli O17:K52:H18 Bifunctional protein aas (aas)

Shipped with Ice Packs
In Stock

Description

Definition and Nomenclature

The Recombinant Escherichia coli O17:K52:H18 Bifunctional Protein Aas (aas) is a recombinant enzyme encoded by the aas gene (locus ECUMN_3163) in E. coli O17:K52:H18, a serotype associated with extraintestinal pathogenic E. coli (ExPEC). This protein exhibits dual enzymatic activities: 2-acylglycerophosphoethanolamine acyltransferase (EC 2.3.1.40) and acyl-ACP synthetase, enabling it to catalyze acyl-group transfers in lipid biosynthesis .

AttributeDetail
UniProt IDB7N768
Gene Synonymsaas, ECUMN_3163, Bifunctional protein Aas
Protein Length719 amino acids (full-length)
Key Domains2-acyl-GPE acyltransferase and acyl-ACP synthetase domains
Expression HostE. coli (recombinant)
TagN-terminal His-tag

Functional Roles in Lipid Metabolism

The bifunctional activity of Aas enables critical steps in lipid biosynthesis:

Enzymatic ActivityFunctionSubstrate/Reaction
2-acylglycerophosphoethanolamine acyltransferaseTransfers acyl groups to 2-acylglycerophosphoethanolamine (GPE), modifying phospholipids.Acyl-CoA + 2-acyl-GPE → acyl-GPE + CoA .
Acyl-ACP synthetaseActivates fatty acids by transferring acyl groups to acyl-carrier protein (ACP), a key step in fatty acid synthesis.Acyl-CoA + ACP → acyl-ACP + CoA .

These activities are vital for membrane lipid remodeling and fatty acid synthesis, though direct links to E. coli pathogenicity remain understudied .

Discrepancies and Considerations

  • Protein Length: Conflicting reports exist between sources. While describe a 719 aa full-length protein, lists a 309 aa construct (UniProt B7NFJ2). This discrepancy may reflect truncated variants or isoforms.

  • Reactivity: No species-specific reactivity data are provided, limiting cross-application insights .

Research Gaps and Future Directions

  1. Pathogenicity Link: While O17:K52:H18 is an ExPEC serotype, the role of Aas in virulence remains unexplored.

  2. Enzymatic Specificity: Detailed kinetic studies on substrate affinities (e.g., acyl-CoA vs. ACP) are lacking.

  3. Structural Insights: Crystallographic data could elucidate domain interactions and catalytic mechanisms .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes if different. We will fulfill requests whenever possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
aas; ECUMN_3163; Bifunctional protein Aas [Includes: 2-acylglycerophosphoethanolamine acyltransferase; 2-acyl-GPE acyltransferase; Acyl-[acyl-carrier-protein]--phospholipid O-acyltransferase; Acyl-[acyl-carrier-protein] synthetase; Acyl-ACP synthetase; Long-chain-fatty-acid--[acyl-carrier-protein] ligase]
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-719
Protein Length
full length protein
Species
Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Target Names
aas
Target Protein Sequence
MLFSFFRNLCRVLYRVRVTGDTQALKGERVLITPNHVSFIDGILLALFLPVRPVFAVYTS ISQQWYMRWLKSFIDFVPLDPTQPMAIKHLVRLVEQGRPVVIFPEGRITTTGSLMKIYDG AGFVAAKSGATVIPVRIEGAELTHFSRLKGLVKRRLFPQITLHILPPTQVEMPDAPRARD RRKIAGEMLHQIMMEARMAVRPRETLYESLLSAMYRFGAGKKCVEDVNFTPDSYRKLLTK TLFVGRILEKYSIEGERIGLMLPNAGISAAVIFGAIARRRIPAMMNYTAGVKGLTSAITA AEIKTIFTSRQFLDKGKLWHLPEQLTQVRWVYLEDLKADVTTADKVWIFSHLLMPRLAQV KQQPEEEALILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFTTNDRFMSALPLFHSFG LTVGLFTPLLTGAEVFLYPSPLHYRIVPELVYDRSCTVLFGTSTFLGHYARFANPYDFYR LRYVVAGAEKLQESTKQLWQDKFGLRILEGYGVTECAPVVSINVPMAAKPGTVGRILPGM DARLLSVPGIEEGGRLQLKGPNIMNGYLRVEKPGVLEVPTAENVRGEMERGWYDTGDIVR FDEQGFVQIQGRAKRFAKIAGEMVSLEMVEQLALGVSPDKVHATAIKSDASKGEALVLFT TDNELTRDKLQQYAREHGVPELAVPRDIRYLKQMPLLGSGKPDFVTLKSWVDEAEQHDE
Uniprot No.

Target Background

Function

This protein plays a crucial role in lysophospholipid acylation. Specifically, it catalyzes the transfer of fatty acids to the 1-position of lysophospholipids via an enzyme-bound acyl-acyl carrier protein (ACP) intermediate, requiring ATP and magnesium ions. Its primary physiological function is the regeneration of phosphatidylethanolamine from 2-acyl-glycero-3-phosphoethanolamine (2-acyl-GPE), a product of transacylation reactions or phospholipase A1 degradation.

Database Links
Protein Families
2-acyl-GPE acetyltransferase family; ATP-dependent AMP-binding enzyme family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Bifunctional protein aas (aas) and what are its primary functions?

The Bifunctional protein aas (aas) from Escherichia coli O17:K52:H18 is a multifunctional enzyme that possesses two distinct catalytic activities: 2-acylglycerophosphoethanolamine acyltransferase and acyl-ACP (acyl carrier protein) synthetase . This protein is also known by several synonyms including "bifunctional acyl-[acyl carrier protein] synthetase/2-acylglycerophosphoethanolamine acyltransferase" and "Acyl-ACP synthetase" . The dual functionality of this protein allows it to play critical roles in bacterial phospholipid metabolism and fatty acid recycling pathways.

The acyltransferase domain is responsible for transferring acyl groups to lysophospholipids, particularly lysophosphatidylethanolamine, contributing to membrane phospholipid remodeling. The acyl-ACP synthetase domain catalyzes the activation of fatty acids by forming thioester bonds with the acyl carrier protein, an essential step in fatty acid metabolism and phospholipid biosynthesis in bacteria. These combined functions make the aas protein an important component in E. coli lipid homeostasis, enabling the bacterium to recycle and reincorporate fatty acids into membrane phospholipids.

The gene encoding this protein, designated as "aas," produces a protein that functions at the interface of fatty acid and phospholipid metabolism pathways. Understanding the structure-function relationships of this bifunctional enzyme provides valuable insights into bacterial membrane biology and potential antimicrobial targets.

What expression systems are commonly used for producing recombinant Bifunctional protein aas?

The production of recombinant Bifunctional protein aas typically employs E. coli as the primary expression host . This homologous expression system is advantageous because it naturally contains the cellular machinery and cofactors required for proper folding and potential post-translational modifications of bacterial proteins. When expressing the aas protein, researchers must consider several factors to optimize yield and functionality.

E. coli expression systems frequently utilize specialized strains designed for high-level protein expression, such as BL21(DE3) or Rosetta strains that provide rare codons. Expression vectors containing inducible promoters (like T7 or tac) allow controlled protein production after the culture reaches appropriate density. For the Bifunctional protein aas specifically, incorporating affinity tags (such as His6, GST, or MBP) facilitates downstream purification while potentially enhancing solubility. Temperature modulation during expression (typically lowering to 16-25°C after induction) can significantly improve proper folding of this complex bifunctional enzyme.

What are the optimal storage conditions for recombinant Bifunctional protein aas?

Optimal storage of recombinant Bifunctional protein aas requires careful consideration of buffer composition, temperature, and handling practices to maintain structural integrity and enzymatic activity. According to product information, the recommended storage condition is -20°C for routine storage, with -80°C preferred for extended storage periods . The protein is typically maintained in a liquid formulation containing glycerol, which acts as a cryoprotectant to prevent freeze-thaw damage .

For working solutions, storing aliquots at 4°C is appropriate for up to one week to minimize freeze-thaw cycles . The storage buffer typically contains 20-50 mM Tris-HCl or phosphate buffer (pH 7.4-8.0), 100-150 mM NaCl, and 10-25% glycerol. Some preparations may benefit from the addition of reducing agents (1-5 mM DTT or 0.5-2 mM TCEP) to prevent oxidation of cysteine residues, and protease inhibitors to minimize degradation.

Researchers should avoid repeated freeze-thaw cycles, which can lead to protein denaturation and loss of enzymatic activity . It is strongly recommended to prepare small working aliquots upon initial thawing for single use. When handling the protein, maintain samples on ice and minimize exposure to room temperature. For applications requiring long-term activity preservation, stability testing under various storage conditions may be necessary, as the specific requirements can vary depending on protein concentration, buffer composition, and intended application.

How can I verify the purity and activity of recombinant Bifunctional protein aas?

Verifying the purity and activity of recombinant Bifunctional protein aas requires a multi-faceted approach combining protein analysis techniques with enzyme-specific activity assays. For purity assessment, SDS-PAGE analysis remains the standard method, where a single predominant band at the expected molecular weight (approximately 80-85 kDa for aas) should be visible, with purity exceeding 90% for most research applications . This can be complemented with Western blotting using antibodies specific to the protein or to affinity tags incorporated in the recombinant construct.

More sophisticated purity analysis can be performed using size-exclusion chromatography to detect aggregates or proteolytic fragments, and mass spectrometry for precise molecular weight determination and peptide fingerprinting. For recombinant proteins intended for structural studies, dynamic light scattering helps assess sample homogeneity and detect aggregation.

For activity verification, a dual approach addressing both enzymatic functions is necessary. The 2-acylglycerophosphoethanolamine acyltransferase activity can be measured using radio-labeled or fluorescently-labeled acyl donors and lysophosphatidylethanolamine acceptors, monitoring the formation of fully acylated phosphatidylethanolamine. The acyl-ACP synthetase activity can be assessed through ATP consumption assays, monitoring pyrophosphate release, or by direct detection of acyl-ACP formation using mobility shift assays or mass spectrometry.

A typical activity assay may contain the following components:

  • 50 mM Tris-HCl, pH 7.5

  • 10 mM MgCl₂

  • 1 mM ATP

  • 0.1-0.5 mM CoA or ACP

  • 0.1-0.5 mM fatty acid substrate

  • 1-5 μg purified recombinant aas protein

Kinetic parameters (Km, Vmax) for each substrate should be determined to establish a reference for batch-to-batch consistency and experimental reproducibility.

What are the recommended protocols for optimizing recombinant Bifunctional protein aas expression?

Optimizing the expression of recombinant Bifunctional protein aas requires systematic adjustment of multiple parameters to achieve maximum yield of functionally active protein. Begin with vector selection, choosing constructs with appropriate promoters (T7, tac) and considering fusion partners that may enhance solubility (MBP, SUMO) while facilitating purification through affinity tags (His, GST) .

The expression protocol should be optimized through systematic testing of the following parameters:

  • Induction timing: Induce at OD600 between 0.6-0.8 for logarithmic phase cells

  • Inducer concentration: Test IPTG concentrations between 0.1-1.0 mM

  • Post-induction temperature: Compare expression at 16°C, 25°C, and 37°C

  • Duration of expression: Test 4, 8, 16, and 24-hour timepoints

A temperature shift strategy often yields better results for complex proteins like aas - grow cells at 37°C until reaching appropriate density, then reduce to 16-18°C before induction and continue expression overnight. This approach balances growth rate with proper protein folding kinetics.

For purification optimization, test multiple buffer conditions varying pH (7.0-8.5), salt concentration (100-500 mM NaCl), and stabilizing additives (glycerol, reducing agents). The bifunctional nature of the aas protein may require specific considerations for maintaining dual activity throughout purification. Activity assays for both enzymatic functions should be performed at each purification step to monitor retention of catalytic activity.

How can isotope labeling be used with recombinant Bifunctional protein aas for structural studies?

Isotope labeling of the recombinant Bifunctional protein aas provides powerful tools for structural characterization using nuclear magnetic resonance (NMR) spectroscopy and mass spectrometry. For NMR studies, uniform ¹⁵N and/or ¹³C labeling enables detailed investigation of protein structure, dynamics, and ligand interactions. This approach is particularly valuable for examining the conformational changes that may occur between the two catalytic domains during substrate binding or catalysis.

The labeling protocol requires expression in minimal media where nitrogen and carbon sources are provided as isotopically enriched compounds (typically ¹⁵NH₄Cl and ¹³C-glucose). A typical labeling procedure follows these steps:

  • Transform expression plasmid into an appropriate E. coli strain (BL21(DE3) or derivatives)

  • Prepare starter culture in rich medium (LB)

  • Wash cells and transfer to M9 minimal medium containing:

    • 48 mM Na₂HPO₄, 22 mM KH₂PO₄, 8.5 mM NaCl, pH 7.4

    • 2 g/L ¹³C-glucose and/or 1 g/L ¹⁵NH₄Cl

    • 1 mM MgSO₄, 0.1 mM CaCl₂

    • Appropriate trace elements and vitamins

  • Grow at 37°C until OD₆₀₀ reaches 0.6-0.8

  • Reduce temperature to 16-18°C and induce with 0.2-0.5 mM IPTG

  • Continue expression overnight (16-18 hours)

For selective labeling approaches, amino acid-specific labeling can be employed by adding labeled amino acids to growth media containing the remaining unlabeled amino acids. Selective ¹⁵N-labeling of specific amino acid types (like lysine or arginine) can simplify NMR spectra interpretation and provide site-specific information about the two different catalytic domains of aas.

Deuteration (²H-labeling) may be required for larger proteins to improve NMR spectral quality by reducing dipolar relaxation. This can be achieved by growing cells in D₂O-based minimal media with deuterated carbon sources, though adaptation periods and typically lower expression yields must be considered. Segmental labeling techniques, where only specific domains are isotopically labeled, could be particularly valuable for the bifunctional aas protein to study each catalytic domain independently.

How does the structure of Bifunctional protein aas influence its dual enzymatic functions?

The Bifunctional protein aas exemplifies nature's elegant solution to metabolic efficiency through domain specialization within a single polypeptide chain. This protein contains two distinct catalytic domains: the N-terminal acyltransferase domain and the C-terminal acyl-ACP synthetase domain . These domains operate with distinct but complementary functions in phospholipid metabolism, forming an integrated molecular machine for fatty acid recycling in bacterial membranes.

The acyltransferase domain exhibits an α/β hydrolase fold characteristic of many lipid-modifying enzymes, with a catalytic triad (typically Ser-His-Asp) positioned to facilitate acyl transfer from acyl donors to lysophospholipid acceptors. This domain recognizes lysophosphatidylethanolamine substrates with high specificity, contributing to membrane phospholipid remodeling.

The acyl-ACP synthetase domain belongs to the adenylate-forming enzyme superfamily, sharing structural homology with fatty acid:CoA ligases. It catalyzes a two-step reaction: first activating fatty acids by forming acyl-adenylate intermediates (consuming ATP), then transferring the activated acyl group to the phosphopantetheine prosthetic group of acyl carrier protein (ACP). This domain exhibits a characteristic nucleotide-binding fold and undergoes substantial conformational changes during the catalytic cycle.

A flexible linker region connects these two domains, potentially allowing conformational adjustments that might coordinate the sequential activities. The spatial arrangement of the domains creates a potential substrate channeling mechanism, where fatty acids liberated from phospholipids by other enzymes can be activated by the synthetase domain and subsequently utilized by the acyltransferase domain for reincorporation into membrane phospholipids. This structural organization minimizes the release of free fatty acids into the cellular environment and enhances the efficiency of lipid recycling pathways.

The bifunctional structure also suggests evolutionary advantages, as gene fusion events often bring together enzymes operating in connected metabolic pathways. In the case of aas, this fusion likely improved the efficiency of fatty acid recycling by coupling the two enzymatic activities that would otherwise require coordinated expression of separate genes.

What techniques are most effective for studying the interaction partners of Bifunctional protein aas?

Investigating the interaction partners of the Bifunctional protein aas requires a multi-technique approach that can capture both stable complexes and transient interactions within lipid metabolism pathways. Affinity purification coupled with mass spectrometry (AP-MS) represents a powerful starting point for identifying the interactome of aas in its native cellular context. This approach typically employs epitope-tagged versions of aas (with tags such as FLAG, HA, or His₆) expressed in E. coli, followed by gentle lysis and affinity capture of protein complexes under near-physiological conditions.

For more dynamic interaction studies, proximity-dependent labeling methods such as BioID or APEX2 are particularly valuable. These approaches involve fusing aas to a biotin ligase or peroxidase enzyme that biotinylates proteins in close proximity, creating a record of interactions that can be subsequently identified by streptavidin pulldown and mass spectrometry. This technique is especially useful for capturing transient interactions with membrane-associated proteins that may be involved in phospholipid metabolism.

Protein-protein interaction networks can be further validated and characterized through targeted approaches:

  • Biolayer interferometry or surface plasmon resonance to quantify binding kinetics and affinity constants between aas and putative partners

  • Crosslinking mass spectrometry to map interaction interfaces at amino acid resolution

  • Förster resonance energy transfer (FRET) or bimolecular fluorescence complementation (BiFC) for visualizing interactions in living cells

  • Co-immunoprecipitation with specific antibodies against suspected interaction partners

When investigating interactions with lipid substrates and membranes, specialized techniques become necessary:

  • Liposome flotation assays to assess membrane binding properties

  • Lipid overlay assays to determine lipid-binding specificity

  • Giant unilamellar vesicle (GUV) binding assays for visualization of membrane interactions

  • Hydrogen-deuterium exchange mass spectrometry to identify lipid-binding interfaces

A particularly informative approach involves reconstituting minimal systems with purified components to directly observe functional interactions. For example, combining recombinant aas with acyl carrier protein, ATP, and lysophospholipid substrates in liposome systems can reveal how these components work together in phospholipid remodeling pathways.

What are the best approaches for studying the kinetics of the dual enzymatic activities?

Investigating the kinetics of the dual enzymatic activities of Bifunctional protein aas requires carefully designed assays that can distinguish and quantify each catalytic function independently and in combination. This bifunctional enzyme presents unique challenges for kinetic characterization due to the potential interdependence of its acyltransferase and acyl-ACP synthetase activities.

For the acyltransferase activity, continuous spectrophotometric assays can be developed using synthetic substrates with chromogenic or fluorogenic leaving groups that produce measurable signals upon acyl transfer. Alternatively, a coupled enzyme assay system may be employed where the product of the acyltransferase reaction feeds into a detection system that generates a measurable signal. Initial rate measurements at varying substrate concentrations allow determination of key kinetic parameters (Km, kcat) for both acyl donors and lysophospholipid acceptors.

For the acyl-ACP synthetase activity, several approaches are effective:

  • ATP consumption assays that couple ADP production to NADH oxidation through pyruvate kinase and lactate dehydrogenase

  • Pyrophosphate release assays using fluorescent or colorimetric detection systems

  • Direct measurement of acyl-ACP formation using conformationally sensitive fluorescent probes attached to ACP

A typical experimental setup for comprehensive kinetic analysis would include:

  • Determination of optimal pH, temperature, and ionic conditions for each activity

  • Substrate specificity profiling using various fatty acids and lysophospholipids

  • Analysis of potential substrate channeling effects by comparing activities with either free fatty acids or fatty acids generated in situ

  • Investigation of potential allosteric regulation by metabolites or membrane components

For integrated analysis of both activities, isothermal titration calorimetry provides thermodynamic insights, while stopped-flow techniques can resolve rapid kinetic phases during catalysis. Pre-steady-state kinetics are particularly valuable for identifying rate-limiting steps and characterizing reaction intermediates.

The table below summarizes key kinetic parameters that should be determined for comprehensive characterization:

ParameterAcyltransferase DomainAcyl-ACP Synthetase Domain
Km (fatty acids)10-100 μM (typical range)5-50 μM (typical range)
Km (lysophospholipids)5-50 μM (typical range)N/A
Km (ATP)N/A0.1-1 mM (typical range)
Km (ACP)N/A1-10 μM (typical range)
kcat1-100 s⁻¹ (typical range)0.1-10 s⁻¹ (typical range)
pH optimumpH 7.0-8.0 (typically)pH 7.5-8.5 (typically)
Temperature optimum30-37°C (typically)25-37°C (typically)

How can researchers address issues with protein instability or aggregation?

Recombinant Bifunctional protein aas may exhibit stability challenges due to its complex dual-domain structure and membrane-interacting properties. When encountering instability or aggregation issues, researchers should implement a systematic troubleshooting approach addressing multiple factors that influence protein stability.

Buffer optimization represents the first line of defense against instability. Consider testing various buffering agents (HEPES, Tris, phosphate) at pH values between 7.0-8.0. The addition of stabilizing agents can dramatically improve protein behavior - glycerol (10-25%) reduces aggregation while maintaining enzyme activity . Additionally, test salt concentrations (100-500 mM NaCl) to identify optimal ionic strength for stability without compromising activity.

Protein aggregation often results from oxidation of surface-exposed cysteine residues. Include reducing agents such as DTT (1-5 mM), β-mercaptoethanol (5-10 mM), or TCEP (0.5-2 mM) to prevent disulfide bond formation. For long-term stability, consider site-directed mutagenesis of non-essential surface cysteines to serine residues, which can significantly enhance stability without affecting function.

The bifunctional nature of aas may lead to domain-domain interactions that affect stability. Consider testing domain-stabilizing additives:

  • Osmolytes like trehalose, sucrose, or arginine (50-200 mM) can stabilize protein conformations

  • Non-detergent sulfobetaines (NDSB-201, 0.5-1 M) reduce protein aggregation

  • For membrane-associated proteins like aas, mild detergents (0.01-0.05% Triton X-100 or 0.5-5 mM CHAPS) may improve stability

If aggregation persists, protein engineering approaches should be considered:

  • Express individual domains separately to identify problematic regions

  • Create fusion constructs with solubility-enhancing partners (MBP, SUMO, Trx)

  • Introduce surface mutations to increase solubility while preserving catalytic sites

  • Optimize the interdomain linker length or composition

For analytical approaches, employ size-exclusion chromatography with multi-angle light scattering (SEC-MALS) to quantitatively assess aggregation states. Thermal shift assays using differential scanning fluorimetry provide rapid screening of stabilizing conditions by monitoring protein unfolding temperatures. Implement these analytical techniques early in purification development to establish a robust stability profile before proceeding to functional studies.

What are common sources of experimental variability when working with Bifunctional protein aas?

Experimental variability when working with Bifunctional protein aas can arise from multiple sources throughout the research workflow, from expression to activity measurement. Recognizing and controlling these variables is essential for generating reproducible and reliable data in enzyme kinetics, structural studies, and functional assays.

Expression and purification variability often stems from inconsistent growth conditions. Batch-to-batch differences in media composition, especially with complex media like LB, can significantly impact protein expression levels. Standardize media preparation protocols and consider defined minimal media for critical experiments. Induction parameters (cell density at induction, IPTG concentration, temperature) should be precisely controlled, as even small variations can alter protein folding and solubility profiles.

The bifunctional nature of the aas protein introduces unique challenges. The two catalytic domains may show different sensitivities to purification conditions, potentially leading to variable ratios of active sites. Implement activity assays for both enzymatic functions during purification to ensure consistent functional properties. Protein concentration determination methods can introduce systematic errors - compare multiple methods (Bradford, BCA, A280) and establish correction factors for accurate quantification.

For enzyme activity measurements, substrate preparation represents a major source of variability. Lipid substrates may form micelles, vesicles, or other aggregates depending on preparation methods, dramatically affecting enzyme accessibility and apparent activity. Standardize lipid preparation protocols, including sonication or extrusion parameters, and characterize substrate presentation states (size distribution, lamellarity) before enzymatic assays.

Environmental factors significantly impact the reproducibility of experiments with this bifunctional enzyme:

  • Temperature fluctuations affect both enzyme activity and substrate properties

  • Trace metal contamination can inhibit or enhance activity (consider including EDTA or specific metal ions)

  • Oxidation of critical residues may occur during storage or experimentation

  • Freeze-thaw cycles can cause activity loss through partial unfolding or aggregation

Implement this data collection strategy to minimize experimental variability:

  • Include internal controls in every experiment (reference protein batches with established activity)

  • Perform technical replicates (minimum triplicate) within each experiment

  • Conduct biological replicates using independently expressed and purified protein batches

  • Use statistical methods appropriate for enzyme kinetics data (non-linear regression, global fitting)

  • Document all experimental conditions comprehensively, including buffer composition, temperature, and equilibration times

By systematically addressing these sources of variability, researchers can establish robust protocols that generate consistent and reliable data when working with this complex bifunctional enzyme.

How does the Bifunctional protein aas compare across different bacterial species?

The Bifunctional protein aas exhibits fascinating evolutionary conservation and divergence across bacterial species, reflecting adaptations to diverse ecological niches and metabolic requirements. Comparative genomic analyses reveal that this bifunctional arrangement is widespread among Gram-negative bacteria, particularly within the Enterobacteriaceae family, suggesting an ancient gene fusion event that provided selective advantages in phospholipid metabolism.

Moving beyond Enterobacteriaceae, greater divergence becomes apparent. In Pseudomonas species, aas homologs show moderate sequence conservation (40-60% identity) but maintain the bifunctional domain arrangement. These more distant homologs often display altered substrate preferences, particularly in acyl chain length specificity, corresponding to the distinctive membrane phospholipid compositions of these bacteria. Some Pseudomonas aas variants show expanded substrate ranges that may contribute to the metabolic versatility of these organisms.

Interestingly, in many Gram-positive bacteria, the functions performed by the bifunctional aas are distributed between separate proteins. This alternative evolutionary strategy achieves similar metabolic outcomes through coordinated expression of distinct enzymes rather than domain fusion. This divergence suggests multiple evolutionary solutions to the challenge of integrating fatty acid activation with phospholipid remodeling.

Remarkably, domain architecture analysis reveals that certain bacterial species contain aas-related proteins with additional functional domains. These expanded variants may coordinate phospholipid metabolism with other cellular processes, such as cell division, stress responses, or virulence mechanisms. For instance, some pathogenic bacteria contain aas homologs with regulatory domains that potentially link membrane remodeling to host interaction processes.

For researchers working with recombinant proteins, these evolutionary insights have practical implications. When the E. coli aas proves challenging to express or crystallize, orthologous proteins from thermophilic bacteria or other species with intrinsically stable proteins may serve as valuable alternatives for structural and mechanistic studies while maintaining the core bifunctional activities of interest.

What are the potential applications of Bifunctional protein aas in synthetic biology?

The Bifunctional protein aas presents compelling opportunities for synthetic biology applications, leveraging its dual enzymatic activities to develop novel biological systems with enhanced lipid metabolism capabilities. The protein's ability to integrate fatty acid activation with phospholipid remodeling makes it an attractive module for designing artificial metabolic pathways with improved efficiency in lipid processing.

Engineered microorganisms for biofuel production represent a promising application area. By incorporating optimized variants of the Bifunctional protein aas into production strains, researchers can potentially enhance fatty acid recycling and reduce carbon loss during biofuel synthesis. Metabolic engineering approaches could redirect fatty acids from membrane phospholipids toward biofuel precursors, using aas as a key enzyme for capturing and activating fatty acids released during cell growth and stress responses. Strategic overexpression of aas, coupled with downstream pathway modifications, could significantly improve carbon efficiency in microbial biofuel factories.

Designer phospholipid production systems offer another exciting application. The acyltransferase activity of aas can be exploited to create novel phospholipid structures with tailored fatty acid compositions. By controlling the availability of specific fatty acid substrates and engineering aas variants with altered substrate specificities, synthetic biologists could produce membrane lipids with customized properties for applications in drug delivery, biosensing, and artificial cell construction.

Protein engineering approaches can further expand the utility of aas in synthetic biology:

  • Domain swapping with related enzymes to create chimeric proteins with novel substrate specificities

  • Directed evolution to enhance thermostability, solvent tolerance, or activity with non-natural substrates

  • Computational design to optimize the interdomain linker for improved catalytic efficiency

  • Fusion with orthogonal binding domains to create scaffolded multienzyme complexes

For biosensor development, aas could be engineered as a sensing component for detecting fatty acids or lysophospholipids in environmental or biological samples. By coupling aas activity to reporter systems that generate optical or electrical signals, researchers could create sensitive detection platforms for lipid metabolites relevant to disease diagnosis or environmental monitoring.

In more advanced synthetic biology applications, aas could contribute to minimal cell design efforts, providing efficient lipid recycling functions with a reduced genetic footprint compared to multiple single-function enzymes. The bifunctional nature of aas exemplifies the type of multifunctional proteins that may be essential for creating streamlined genomes with maximized metabolic efficiency per genetic element.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.