Recombinant Escherichia coli O17:K52:H18 Cardiolipin synthase (cls)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Escherichia coli O17:K52:H18 Cardiolipin Synthase (Cls)

Escherichia coli ( E. coli) strains, such as O17:K52:H18, can cause extraintestinal infections . Cardiolipin (CL) is an anionic phospholipid primarily found in energy-transducing membranes of bacteria and mitochondria . It plays a crucial role in various cellular processes, including energy metabolism, stabilization of protein complexes, and organization of molecular machines on the membrane surface . Cardiolipin synthase (Cls) is the enzyme responsible for catalyzing the final step in cardiolipin biosynthesis .

Cardiolipin Synthases in E. coli

E. coli has three Cls isoenzymes: ClsA, ClsB, and ClsC . All three Cls enzymes contain the phospholipase D (PLD) characteristic HKD motive and synthesize CL using PLD activity . These enzymes catalyze the condensation of two phosphatidylglycerol (PG) molecules to form CL and glycerol .

  • ClsA and ClsB: Mutation of the cls gene (now annotated clsA) results in reduced CL production and sensitization of cells to low osmolarity . Both ClsA and ClsB can restore CL levels to near wild-type levels in stationary phase in a triple mutant (∆clsABC) .

  • ClsC: ClsC has sequence homology with ClsA and ClsB, and it also belongs to the phospholipase D superfamily . Expression of clsC alone results in a low level of CL in the stationary phase, which increased to near wild-type levels by coexpression of its neighboring gene, ymdB .

Methods for Studying Cardiolipin Synthase

  • LC-MS Analysis: Lipidomic studies using liquid chromatography-mass spectrometry (LC-MS) have been employed to investigate the effect of overexpressing or deleting the three individual Cls enzymes on the lipidome, which included changes in lipid class distribution and CL species profiles .

  • Expression and Complementation Studies: The three cls genes with ribosome-binding sites were cloned into the arabinose inducible pBAD30 vector and individually transformed into a ∆clsABC mutant to study the expression of CL synthases .

  • Activity Assays: A simple, specific, and sensitive assay procedure for cardiolipin synthase of Escherichia coli has been developed, which measures the radioactivity of glycerol formed from phosphatidyl [2-3H]glycerol .

Role of YmdB in ClsC Function

The clsC gene is separated by one base pair in the same operon from the preceding gene, ymdB, which encodes a protein containing a macro domain with a predicted adenosine diphosphate (ADP) ribose-binding potential . Co-overexpression of both proteins in the ∆clsABC mutant resulted in a CL level comparable to that with overexpression of clsA or clsB individually .

Implications and Significance

  • Bacterial Physiology: CL is essential for optimal bacterial and mitochondrial stability and function .

  • Evolutionary Insights: Studies on E. coli O157:H7 have provided insights into the evolution of this strain from its O55:H7 ancestor, including changes in gene content and mutation rates .

  • Pathogenicity: Certain E. coli isolates, including O17:K52:H18, are associated with extraintestinal infections, highlighting the clinical relevance of understanding their virulence factors and metabolic pathways .

  • Commercial Availability: Recombinant Escherichia coli O17:K52:H18 Cardiolipin synthase (cls) is available for purchase for ELISA assays .

Data Tables

GeneEnzymeFunction
clsAClsACardiolipin synthesis; contributes detectible levels of CL at low osmolarity during logarithmic growth
clsBClsBCardiolipin synthesis; phospholipid headgroup exchange
clsCClsCCardiolipin synthesis; requires YmdB for optimal activity

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
clsA; cls; ECUMN_1546; Cardiolipin synthase A; CL synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-486
Protein Length
full length protein
Species
Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Target Names
clsA
Target Protein Sequence
MTTVYTLVSWLAILGYWLLIAGVTLRILMKRRAVPSAMAWLLIIYILPLVGIIAYLAVGE LHLGKRRAERARAMWPSTAKWLNDLKACKHIFAEENSSVAAPLFKLCERRQGIAGVKGNQ LQLMTESDDVMQALIRDIQLARHNIEMVFYIWQPGGMADQVAESLMAAARRGIHCRLMLD SAGSVAFFRSPWPELMRNAGIEVVEALKVNLMRVFLRRMDLRQHRKMIMIDNYIAYTGSM NMVDPRYFKQDAGVGQWIDLMARMEGPIATAMGIIYSCDWEIETGKRILPPPPDVNIMPF EQASGHTIHTIASGPGFPEDLIHQALLTAAYSAREYLIMTTPYFVPSDDLLHAICTAAQR GVDVSIILPRKNDSMLVGWASRAFFTELLAAGVKIYQFEGGLLHTKSVLVDGELSLVGTV NLDMRSLWLNFEITLAIDDKGFGADLAAVQDDYISRSRLLDARLWLKRPLWQRVAERLFY FFSPLL
Uniprot No.

Target Background

Function
Catalyzes the reversible transfer of phosphatidyl groups between phosphatidylglycerol molecules, resulting in the formation of cardiolipin (CL, diphosphatidylglycerol) and glycerol.
Database Links
Protein Families
Phospholipase D family, Cardiolipin synthase subfamily, ClsA sub-subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is cardiolipin synthase and what role does it play in bacterial physiology?

Cardiolipin synthase is an essential enzyme that catalyzes the final step in cardiolipin biosynthesis, a unique phospholipid critical for bacterial membrane stability and function . In E. coli, the cls gene encodes cardiolipin synthase, which synthesizes cardiolipin from two molecules of phosphatidylglycerol . This synthesis process differs mechanistically between prokaryotes and eukaryotes, with bacteria utilizing a condensation reaction between phosphatidylglycerol molecules . Cardiolipin contributes to membrane integrity, osmotic stability, and supports various membrane-associated functions including energy metabolism and protein complex formation. The unique tetraacyl structure with two phosphate groups distinguishes cardiolipin from other membrane lipids, suggesting specialized roles in bacterial membrane functions .

How does cardiolipin synthesis in prokaryotes differ from that in eukaryotes?

The final step in cardiolipin biosynthesis is catalyzed by cardiolipin synthase in both prokaryotes and eukaryotes, but the mechanisms differ significantly between these domains of life . In prokaryotes like E. coli, cardiolipin synthesis occurs via a phosphatidyl transfer reaction where one phosphatidylglycerol transfers its phosphatidyl group to another phosphatidylglycerol molecule, resulting in cardiolipin and glycerol . This reaction is catalyzed by a bacterial-type cardiolipin synthase encoded by the cls gene .

What genetic approaches can be used to study the cls gene function in E. coli?

Several genetic approaches can be employed to study cls gene function in E. coli:

  • Gene disruption: The cls gene can be disrupted by either insertion of or replacement with a selectable marker gene (such as a kanamycin-resistance gene) followed by exchange with the homologous chromosomal region . Confirmation of proper disruption requires Southern blot hybridization and transductional linkage analysis .

  • Complementation studies: Introducing a plasmid carrying an intact cls gene into cls-deficient strains can restore normal growth and cardiolipin synthesis, confirming the specific role of the cls gene product .

  • Conditional expression systems: For essential genes or to study phenotypic effects, conditional expression systems using inducible promoters can allow controlled expression of the cls gene.

  • Site-directed mutagenesis: Creating specific mutations in the cls gene can help identify critical residues for enzyme function and substrate specificity.

In E. coli, cls gene disruption results in undetectable cardiolipin synthase activity, although cells remain viable with reduced growth rates and final culture densities compared to wild-type strains . This viability despite cls disruption suggests that while the cls gene provides growth advantages, it may not be absolutely essential under standard laboratory conditions.

What are the most reliable methods for measuring cardiolipin synthase activity in E. coli?

Reliable measurement of cardiolipin synthase activity in E. coli typically employs biochemical assays with appropriate controls. The following methodological approaches are recommended:

  • In vitro enzyme assays: Using purified or partially purified enzyme preparations, cardiolipin synthase activity can be measured by monitoring the conversion of phosphatidylglycerol to cardiolipin . This typically involves radiolabeled substrates (such as 32P-labeled phosphatidylglycerol) and thin-layer chromatography (TLC) separation of products.

  • Membrane fraction assays: Since cardiolipin synthase is a membrane-associated enzyme, isolated membrane fractions can be used to measure enzyme activity in a more native environment.

  • Comparative analysis with knockout strains: Comparing enzyme activity between wild-type and cls-disrupted strains provides validation of assay specificity .

  • Complementation-based activity assessment: Measuring restored enzyme activity in cls-disrupted strains carrying plasmids with intact cls gene can confirm the specificity of the assay and the functional relationship between gene and enzyme activity .

When designing such experiments, it's critical to control for potential alternative pathways of cardiolipin formation, as even cls-null mutants may exhibit low levels of cardiolipin synthesis through other enzymes such as phosphatidylserine synthase .

How should researchers design experiments to study cardiolipin distribution in bacterial membranes?

Studying cardiolipin distribution in bacterial membranes requires careful experimental design to avoid artifacts and misinterpretation. Based on current research, the following considerations are essential:

  • Fluorescent labeling controls: While 10-N-nonyl acridine orange (NAO) has been used to visualize cardiolipin domains, its specificity should be verified for each bacterial species using appropriate cardiolipin synthase-deficient strains . NAO fluorescence is not universally reliable as a cardiolipin reporter, as demonstrated in Bacillus subtilis studies .

  • Multiple staining techniques: Using multiple membrane dyes with different properties, such as both charged (NAO) and uncharged (Nile Red) fluorescent probes, helps distinguish charge-dependent from general membrane domain phenomena .

  • Genetic controls: Experiments should include cardiolipin synthase-deficient strains (cls knockout strains) to verify the specificity of observed membrane domains .

  • Biochemical verification: Thin layer chromatography of extracted membrane lipids should be performed to confirm the presence or absence of cardiolipin in experimental strains .

  • Environmental conditions control: Membrane domain formation can be influenced by environmental factors such as temperature (cold shock can induce domain formation independent of cardiolipin in some bacteria) .

The evidence from B. subtilis studies cautions that the potential lipid-specificity of NAO must be verified for each bacterial species on a case-by-case basis . Even in the absence of detectable cardiolipin, membrane domains may form under certain conditions, indicating that observed domains are not necessarily specific cardiolipin clusters .

What are the best methods for isolating and purifying recombinant cardiolipin synthase from E. coli?

Isolation and purification of recombinant cardiolipin synthase from E. coli require specialized techniques due to its membrane-associated nature. The following methodological approach is recommended:

  • Expression system selection: Use of an appropriate expression vector with a strong, inducible promoter (such as T7 or tac) and a host strain optimized for membrane protein expression (such as C41(DE3) or C43(DE3)).

  • Affinity tagging: Addition of an affinity tag (His6, FLAG, or Strep-tag) to either the N- or C-terminus facilitates purification, though tag position should be optimized to minimize interference with enzyme activity.

  • Membrane fraction isolation: After cell disruption by methods such as sonication or French press, differential centrifugation is used to isolate membrane fractions containing the enzyme.

  • Detergent solubilization: Careful selection of detergents (such as n-dodecyl-β-D-maltoside, digitonin, or Triton X-100) at optimized concentrations is critical for efficient solubilization while preserving enzyme activity.

  • Chromatographic purification: Sequential purification typically involves:

    • Affinity chromatography (based on the chosen tag)

    • Ion exchange chromatography

    • Size exclusion chromatography

  • Activity verification: Each purification step should be monitored for cardiolipin synthase activity to ensure the enzyme remains functional throughout the process.

  • Reconstitution into liposomes: For functional studies, the purified enzyme can be reconstituted into liposomes with defined lipid composition.

Blue-native gel electrophoresis can be employed to study the native protein complex association, as cardiolipin synthase has been shown to be part of a large protein complex in the inner membrane .

What is the molecular mechanism by which cardiolipin supports mitochondrial and bacterial membrane protein complexes?

Cardiolipin plays a crucial role in supporting membrane protein complexes through several molecular mechanisms:

  • Structural support: Cardiolipin's unique dimeric structure with four acyl chains and two phosphate groups creates a conical shape that promotes negative membrane curvature, which can stabilize protein complexes in curved membrane regions .

  • Protein-lipid interactions: Cardiolipin forms specific interactions with membrane proteins through electrostatic attractions between its negatively charged headgroups and positively charged protein residues. These interactions can:

    • Stabilize protein conformations

    • Facilitate proper protein folding

    • Mediate interactions between protein subunits

  • Proton trapping: Cardiolipin can trap protons at the membrane surface, facilitating proton movement along membrane-embedded complexes, which is particularly important for respiratory chain components .

  • Membrane domain organization: Cardiolipin helps organize specialized membrane domains that concentrate specific proteins, enhancing their functional efficiency .

In mitochondria, cardiolipin depletion results in:

  • Mitochondrial fragmentation

  • Loss of membrane potential

  • Decreased levels of respiratory complex components such as cytochrome oxidase subunit IV and cytochrome c1

These effects highlight cardiolipin's role in maintaining mitochondrial morphology and functional integrity of respiratory complexes. Similarly, in bacteria, cardiolipin influences the organization and function of membrane protein complexes involved in energy metabolism, cell division, and transport .

The evidence from studies in Trypanosoma brucei shows that cardiolipin synthase colocalizes with inner mitochondrial membrane proteins and forms part of a large protein complex, suggesting a direct spatial relationship between cardiolipin synthesis and the membrane protein complexes it supports .

How do alternative pathways of cardiolipin formation function in cls-null mutants of E. coli?

Studies of cls-null mutants in E. coli have revealed the existence of alternative pathways for cardiolipin formation, though at significantly reduced levels compared to wild-type strains. The mechanisms and regulation of these alternative pathways include:

  • Phosphatidylserine synthase involvement: Evidence suggests that phosphatidylserine synthase (encoded by the pss gene) may contribute to minor cardiolipin formation in cls mutants . This is supported by the observation that cardiolipin content in cls mutants depends on the dosage of the pss gene, and attempts to transfer a null allele of the cls gene into a pss-1 mutant were unsuccessful .

  • Potential enzymatic mechanism: While the primary cardiolipin synthase catalyzes the condensation of two phosphatidylglycerol molecules, alternative pathways might involve:

    • Side reactions of other phospholipid biosynthetic enzymes

    • Non-enzymatic phospholipid condensation under specific conditions

    • Uncharacterized enzymes with weak cardiolipin synthase activity

  • Regulatory implications: The persistence of low cardiolipin levels in cls-null mutants suggests:

    • Potential functional importance of maintaining minimal cardiolipin levels

    • Existence of regulatory mechanisms that activate alternative pathways when the primary synthesis route is compromised

    • Metabolic flexibility in phospholipid biosynthesis

  • Physiological significance: The essential nature of cardiolipin is suggested by the inability to create a double mutant lacking both cls and pss functions . This indicates that at least one pathway for cardiolipin formation may be required for E. coli survival.

Researchers investigating these alternative pathways should consider:

  • Creating conditional mutants in multiple phospholipid biosynthetic genes

  • Using isotope labeling to trace phospholipid precursors

  • Examining the effects of environmental conditions on alternative pathway activation

  • Comparing phospholipid profiles across multiple growth phases

What are the limitations of using NAO (10-N-nonyl acridine orange) for detecting cardiolipin in different bacterial species?

While NAO has been widely used as a fluorescent dye to visualize cardiolipin in bacterial membranes, recent research has identified significant limitations to this approach, which researchers should carefully consider:

  • Lack of universal specificity: NAO is not a universally reliable reporter for cardiolipin across bacterial species. In Bacillus subtilis, NAO-stained domains were observed even in cardiolipin synthase-deficient strains that lacked detectable cardiolipin, demonstrating that the observed domains were not specific cardiolipin clusters .

  • Alternative binding targets: NAO can bind to other anionic phospholipids beyond cardiolipin. In E. coli, NAO-stained polar lipid domains have been reported in the absence of cardiolipin, with evidence suggesting binding to phosphatidylglycerol and potentially other negatively charged phospholipids .

  • Concentration-dependent effects: At elevated concentrations, NAO can induce domain formation independent of cardiolipin content, potentially creating artifacts that may be misinterpreted as physiological lipid domains .

  • Cold shock interference: Cold shock can trigger formation of lipid domains that stain with NAO in a manner independent of cardiolipin content, as demonstrated in B. subtilis .

  • Red fluorescence specificity claims: The red wavelength emission of NAO has been postulated to be specific for cardiolipin, but evidence from B. subtilis indicates no noticeable difference in the intensity of fluorescence staining in this wavelength range between cardiolipin-producing and cardiolipin-deficient cells .

To address these limitations, researchers should:

As emphasized in the B. subtilis study, "the potential lipid-specificity of NAO must be verified for the used bacterial species on a case-by-case basis, by using appropriate lipid synthase deletion strains" .

What analytical techniques provide the most comprehensive phospholipid profile for E. coli with modified cardiolipin synthesis?

Comprehensive phospholipid profiling of E. coli with modified cardiolipin synthesis requires a multi-technique approach to capture both quantitative and qualitative changes in the membrane lipidome:

  • Thin Layer Chromatography (TLC):

    • Provides efficient separation of different phospholipid classes

    • Useful for comparing wild-type and cls mutant strains

    • Can detect the presence or absence of cardiolipin and other major phospholipids

    • Limitations include lower sensitivity and resolution compared to more advanced techniques

  • Liquid Chromatography-Mass Spectrometry (LC-MS):

    • Offers high sensitivity and molecular species resolution

    • Enables identification and quantification of individual molecular species within each phospholipid class

    • Can detect minor lipid species that might compensate for cardiolipin deficiency

    • Particularly useful for monitoring acyl chain composition changes in response to cls modification

  • 31P Nuclear Magnetic Resonance (NMR):

    • Provides quantitative information on phospholipid headgroup distribution

    • Non-destructive analysis of membrane extracts

    • Can detect unusual phospholipid species that might arise in cls mutants

  • Lipidomics approach:

    • Combines multiple analytical platforms for comprehensive characterization

    • Includes analysis of fatty acid composition by Gas Chromatography-Mass Spectrometry (GC-MS)

    • Incorporates data analysis workflows to identify statistically significant changes across the lipidome

  • Analytical considerations:

    • Sample preparation must be standardized across experimental conditions

    • Growth phase affects phospholipid composition and should be controlled

    • Environmental conditions (temperature, media composition) influence phospholipid profiles

    • Extraction methods should be optimized to recover all phospholipid classes efficiently

A comprehensive analytical workflow should include:

  • Extraction of total lipids using Bligh-Dyer or similar methods

  • Initial screening by TLC for major phospholipid changes

  • Detailed analysis by LC-MS for molecular species characterization

  • Validation of key findings using orthogonal techniques such as 31P NMR

  • Integration of lipidomic data with physiological or gene expression changes

This multi-faceted approach provides the most detailed understanding of how cls modification affects the entire phospholipid profile and identifies potential compensatory mechanisms that maintain membrane function in the absence of normal cardiolipin levels.

What are the most effective strategies for analyzing the impact of cls gene disruption on bacterial membrane potential and integrity?

Analyzing the impact of cls gene disruption on bacterial membrane potential and integrity requires a comprehensive experimental approach combining multiple complementary techniques:

  • Membrane potential measurement techniques:

    • Fluorescent potentiometric probes such as DiOC2(3) or JC-1 provide quantitative assessment of membrane potential changes

    • Microelectrode techniques for direct measurement of transmembrane potential

    • Flow cytometry analysis of potential-sensitive dyes allows single-cell resolution assessment and population heterogeneity analysis

    • Time-course experiments to track membrane potential dynamics following cls disruption

  • Membrane integrity assessment:

    • Permeability assays using membrane-impermeable fluorescent dyes (propidium iodide, SYTOX Green)

    • Measurement of ion or metabolite leakage from cells

    • Atomic force microscopy to evaluate membrane mechanical properties

    • Freeze-fracture electron microscopy to examine membrane ultrastructure

  • Osmotic stability testing:

    • Survival rates under hypo- and hyperosmotic shock conditions

    • Time-course of adaptation to osmotic stress

    • Measurement of compatible solute accumulation and release

  • Physiological measurements:

    • Oxygen consumption rates to assess respiratory function

    • ATP synthesis capacity measurement

    • Proton motive force determination

    • Growth kinetics under various environmental stresses

  • Complementation studies:

    • Restoration of wild-type cls gene expression to confirm direct relationship between observed phenotypes and cardiolipin deficiency

    • Expression of heterologous cardiolipin synthases to assess functional conservation

Evidence from Trypanosoma brucei studies demonstrates that cardiolipin depletion leads to mitochondrial fragmentation and loss of membrane potential, suggesting critical roles in maintaining organelle morphology and bioenergetic functions . In E. coli, disruption of the cls gene results in reduced growth rates and final culture densities compared to wild-type strains, indicating physiological consequences of cardiolipin deficiency even under standard growth conditions .

When designing experiments to assess membrane function in cls mutants, researchers should consider:

  • The growth phase of bacteria, as membrane properties change during different phases

  • Environmental conditions that might exacerbate membrane defects

  • Potential compensatory mechanisms that might mask phenotypes under standard conditions

  • The need for multiple complementary techniques to confirm observations

How should researchers interpret changes in growth kinetics and stress responses in cls-deficient E. coli strains?

Interpreting changes in growth kinetics and stress responses in cls-deficient E. coli requires careful consideration of multiple factors and potential compensatory mechanisms:

A comprehensive interpretation should acknowledge that while cardiolipin is not absolutely essential for E. coli viability under standard laboratory conditions, it provides significant growth and survival advantages, particularly under stress conditions . The inability to create double mutants lacking both cls and pss functions suggests that maintaining at least minimal cardiolipin levels may be essential for bacterial survival under certain conditions .

What statistical approaches are most appropriate for analyzing lipidomic data from recombinant E. coli with modified cardiolipin synthesis?

Analyzing lipidomic data from recombinant E. coli with modified cardiolipin synthesis requires sophisticated statistical approaches to account for the complexity and interdependence of lipid metabolism:

  • Data preprocessing and normalization:

    • Total ion current normalization to account for injection volume variations

    • Internal standard normalization using appropriate lipid standards

    • Log transformation to address non-normal distribution of lipid concentrations

    • Batch effect correction using methods such as ComBat or LOESS normalization

    • Quality control sample inclusion to monitor analytical stability

  • Univariate statistical methods:

    • Student's t-test or ANOVA for comparing lipid species across experimental groups

    • Non-parametric alternatives (Mann-Whitney U, Kruskal-Wallis) for non-normally distributed data

    • Multiple testing correction (Benjamini-Hochberg, Bonferroni) to control false discovery rate

    • Effect size calculation (Cohen's d, fold change) to assess biological significance

  • Multivariate statistical approaches:

    • Principal Component Analysis (PCA) for unsupervised exploration of lipidome variations

    • Partial Least Squares Discriminant Analysis (PLS-DA) for supervised classification

    • Orthogonal Projections to Latent Structures (OPLS) to separate predictive from orthogonal variations

    • Hierarchical clustering to identify co-regulated lipid species

  • Pathway and network analysis:

    • Enrichment analysis of lipid classes and subclasses

    • Network reconstruction of lipid metabolic pathways

    • Integration with transcriptomic data of lipid biosynthetic genes

    • Bayesian network analysis to infer causal relationships between lipid changes

  • Time-series data analysis:

    • Mixed-effects models to account for repeated measurements

    • Time-course trajectory clustering

    • Dynamic network analysis to capture temporal regulation patterns

  • Validation approaches:

    • Cross-validation techniques (k-fold, leave-one-out) to assess model robustness

    • Permutation testing to evaluate statistical significance

    • Independent validation cohorts when possible

    • Biological validation through targeted experiments

When analyzing lipidomic data from cls-modified E. coli, researchers should pay particular attention to:

  • Compensatory changes in other phospholipid classes (phosphatidylglycerol, phosphatidylethanolamine)

  • Alterations in acyl chain composition that might maintain membrane properties

  • Correlation between lipidome changes and phenotypic observations

  • Changes in minor lipid species that might have significant functional impacts

Sample size calculation for lipidomic studies should account for the high dimensionality of the data and expected effect sizes. A minimum of 5-6 biological replicates per condition is typically recommended, with power analysis performed based on pilot data when available.

What are the most promising research avenues for developing cls-based antimicrobial strategies?

The exploration of cardiolipin synthase (cls) as a target for antimicrobial development represents an emerging area with several promising research directions:

  • Structure-based drug design approaches:

    • Determination of high-resolution crystal structures of bacterial cardiolipin synthases

    • Computational screening of compound libraries against cls active sites

    • Fragment-based drug discovery targeting conserved catalytic residues

    • Development of transition-state analogs as potential inhibitors

  • Exploitation of prokaryotic-eukaryotic differences:

    • Targeting the mechanistic differences between bacterial and eukaryotic cardiolipin synthesis pathways

    • Focus on bacterial-type cardiolipin synthases present in certain eukaryotic pathogens (like T. brucei)

    • Development of inhibitors selective for bacterial cls enzymes over mammalian counterparts

  • Combination therapy strategies:

    • Investigation of synergy between cls inhibitors and existing antibiotics

    • Targeting multiple enzymes in the phospholipid biosynthesis pathway

    • Identifying cls-dependent vulnerabilities that can be exploited by other antimicrobials

  • Serotype-specific approaches:

    • Characterization of cls variations among pathogenic E. coli serotypes

    • Development of serotype-targeted inhibitors for uropathogenic strains like O15:K52:H1

    • Exploration of serotype-specific membrane composition differences

  • Virulence modulation strategies:

    • Investigation of cls inhibition as a means to attenuate bacterial virulence without killing

    • Development of anti-virulence compounds that target cls-dependent pathogenic mechanisms

    • Exploration of cls as a target for reducing biofilm formation

  • Methodological considerations:

    • Development of high-throughput screening assays for cls inhibitors

    • Optimization of whole-cell screening approaches to ensure membrane permeability

    • Establishment of relevant in vivo infection models for validating cls-targeting compounds

  • Challenges to address:

    • The viability of cls-deficient E. coli in laboratory conditions suggests potential for resistance development

    • Alternative pathways for cardiolipin formation might compensate for cls inhibition

    • Delivery of inhibitors across bacterial membranes may present pharmacological challenges

The observation that E. coli can survive without functional cardiolipin synthase but with growth disadvantages suggests that cls inhibitors might function as anti-virulence agents rather than bactericidal compounds . Such agents could potentially reduce pathogen fitness during infection while imposing less selective pressure for resistance development.

How might future research address the evolutionary implications of bacterial-type cardiolipin synthase in select eukaryotes?

The discovery of bacterial-type cardiolipin synthase in eukaryotic organisms like Trypanosoma brucei presents a fascinating evolutionary puzzle with significant research potential . Future research in this area could explore:

  • Phylogenetic analysis approaches:

    • Comprehensive phylogenomic analysis of cardiolipin synthase genes across all domains of life

    • Dating of potential horizontal gene transfer events

    • Correlation of cls type with organelle evolution

    • Synteny analysis of genomic regions surrounding the bacterial-type cls genes in eukaryotes

  • Structural and functional comparative studies:

    • High-resolution structural comparison between prokaryotic cls enzymes and their eukaryotic counterparts

    • Functional complementation experiments across species boundaries

    • Analysis of substrate specificity differences between bacterial and eukaryotic-type enzymes

    • Investigation of regulatory mechanisms across evolutionary diverse organisms

  • Mitochondrial evolution research:

    • Examination of cardiolipin synthesis as a marker for mitochondrial evolutionary history

    • Comparison between hydrogenosomes, mitosomes, and mitochondria regarding cardiolipin metabolism

    • Investigation of the relationship between endosymbiont acquisition and cardiolipin synthesis evolution

  • Experimental evolution approaches:

    • Laboratory evolution experiments to study adaptation of cls function

    • Synthetic biology approaches to swap cls types between organisms

    • Creation of hybrid cls enzymes to understand functional domain evolution

  • Metabolic integration studies:

    • Systems biology analysis of cardiolipin metabolism integration into eukaryotic networks

    • Comparative metabolomics across species with different cls types

    • Investigation of how bacterial-type cls interacts with eukaryotic regulatory systems

  • Medical and biotechnological applications:

    • Exploration of bacterial-type cls in eukaryotic pathogens as drug targets

    • Development of evolutionary-informed strategies for parasite control

    • Biotechnological applications leveraging the unique properties of bacterial-type cls in eukaryotic systems

The evidence that T. brucei utilizes a bacterial-type cardiolipin synthase provides a unique opportunity to study the consequences of this evolutionary arrangement . The discovery challenges conventional understanding of phospholipid biosynthesis evolution and suggests previously unrecognized evolutionary connections.

Future research should address whether this represents an example of horizontal gene transfer, retention of an ancestral trait, or convergent evolution, with implications for our understanding of eukaryotic cell evolution and the endosymbiotic theory of mitochondrial origin.

Concluding Remarks and Future Perspectives

The study of cardiolipin synthase in E. coli represents an important intersection of bacterial physiology, membrane biochemistry, and potential antimicrobial development. While specific research on the O17:K52:H18 serotype is limited in available literature, the broader principles of cardiolipin synthesis and function in E. coli provide valuable insights for researchers.

Current evidence indicates that cardiolipin synthase in E. coli is encoded by the cls gene and catalyzes the formation of cardiolipin from two phosphatidylglycerol molecules . While not absolutely essential for bacterial survival under laboratory conditions, cardiolipin contributes significantly to optimal growth and membrane function . The persistence of low cardiolipin levels in cls-null mutants suggests the existence of alternative synthesis pathways, potentially involving phosphatidylserine synthase .

The technical challenges of studying cardiolipin localization and function are significant, with evidence indicating that commonly used methods such as NAO staining may not provide reliable results across all bacterial species . Researchers must employ multiple complementary techniques and appropriate controls when investigating cardiolipin's role in bacterial physiology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.