Recombinant Escherichia coli O17:K52:H18 Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Description

Enzymatic Function and Biological Role

CobS (EC 2.7.8.26) is a cobalamin synthase that participates in the final steps of vitamin B<sub>12</sub> biosynthesis. In E. coli O17:K52:H18, it functions within the cob operon alongside cobU and cobT :

  • Substrate specificity: Acts on adenosylcobinamide-phosphate and GTP to produce adenosylcobalamin-5′-phosphate .

  • Cofactor dependency: Requires cobalt chelation for activity, facilitated by transport proteins like CbiMNQO .

  • Physiological impact: Overexpression disrupts membrane potential by dissipating the proton motive force (PMF), necessitating coexpression of cobC (phosphatase) and pspA (membrane stabilizer) for viability .

Recombinant Production and Purification

Recombinant CobS is synthesized using plasmid-based systems in E. coli hosts :

Expression Systems

  • Host: E. coli BL21(DE3) or similar strains .

  • Vector: pET or pCDFDuet plasmids with inducible promoters (e.g., T7/lac) .

  • Yield: Up to 85% purity via Ni-NTA affinity chromatography .

Optimization Strategies

  • Cobalt supplementation: Enhances enzyme activity by ensuring adequate cobalt availability .

  • Coexpression partners: cobC (phosphatase) and cobT (dimethylbenzimidazole phosphoribosyltransferase) improve pathway flux .

Metabolic Engineering for Vitamin B<sub>12</sub> Production

In engineered E. coli strains, CobS is part of a 28-gene pathway enabling de novo vitamin B<sub>12</sub> synthesis :

  • Module integration: CobS operates in Module 5, converting adenosylcobinamide-phosphate to adenosylcobalamin .

  • Productivity: Optimized strains produce 307.00 µg vitamin B<sub>12</sub> per gram of dry cell weight .

Toxicity and Mitigation

Overexpression of CobS in E. coli causes:

  • PMF dissipation: Leads to cytoplasmic acidification and membrane destabilization .

  • Rescue mechanisms: Coexpression of pspA restores membrane integrity, improving cell viability .

Challenges and Future Directions

  • Bottlenecks: Cobalt chelation efficiency and CobS-CobC complex stability limit yields .

  • Engineering targets: Directed evolution to enhance enzyme kinetics or reduce toxicity .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we accommodate specific format requests. Please indicate your preference when placing the order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. For dry ice shipping, please communicate with us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
cobS; ECUMN_2328; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Target Names
cobS
Target Protein Sequence
MSKLFWAMLSFITRLPVPRRWSQGLDFEHYSRGIITFPLIGLLLGAISGLVFMALQAWFG VPLAALFSVLVLALMTGGFHLDGLADTCDGVFSARSRDRMLEIMRDSRLGTHGGLALIFV VLAKILVLSELALRGEPILASLAAACAVSRGTAALLMYRHRYAREEGLGNVFIGKIDGRQ TCVTLGLAAIFAAVLLPGMHGVAAMVVTMVAIFILGQLLKRTLGGQTGDTLGAAIELGEL VFLLALL
Uniprot No.

Target Background

Function
Cobalamin synthase (CobS) catalyzes the conversion of adenosylcobinamide-GDP and alpha-ribazole to adenosylcobalamin (Ado-cobalamin). Additionally, it synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and alpha-ribazole 5'-phosphate.
Database Links
Protein Families
CobS family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Cobalamin synthase (CobS) and what is its function?

Cobalamin synthase (CobS) is an enzyme that catalyzes a critical step in the biosynthesis of adenosylcobalamin (vitamin B12). Specifically, CobS functions as a cobalamin-5′-phosphate synthase, catalyzing the attachment of the nucleotide loop to adenosylcobinamide-GDP in the nucleotide loop assembly pathway. This reaction is essential for completing the structure of cobalamin by connecting the lower ligand base to the corrin ring system .

In Salmonella typhimurium, which has a similar cobalamin biosynthetic pathway to E. coli, CobS works together with CobU, CobT, and CobC proteins in the late steps of adenosylcobalamin biosynthesis. These enzymes collectively define the nucleotide loop assembly pathway, which is crucial for the final structure and function of cobalamin .

What are the substrates and products of the CobS reaction?

The CobS enzyme catalyzes a specific reaction in the cobalamin biosynthesis pathway:

Substrates:

  • Adenosylcobinamide-GDP (AdoCbi-GDP) - the product of the CobU reaction

  • α-Ribazole-5′-phosphate - the product of the CobT reaction

Product:

  • Adenosylcobalamin-5′-phosphate (AdoCbl-5′-P)

Experimental evidence has shown that when AdoCbi-GDP and α-ribazole-5′-P are incubated with purified CobS, the enzyme successfully synthesizes AdoCbl-5′-P, which can support the growth of cobalamin auxotrophs .

What is known about the structure of CobS from E. coli O17:K52:H18?

While the search results don't provide specific structural information about CobS from E. coli O17:K52:H18, research on similar CobS proteins suggests that it belongs to a family of nucleotide transferases. The enzyme likely has specific binding domains for its substrates AdoCbi-GDP and α-ribazole-5′-phosphate.

Detailed structural information would typically be obtained through X-ray crystallography, NMR spectroscopy, or cryo-electron microscopy studies. Researchers interested in the structure-function relationship of CobS should consider these methodologies for further investigation.

How can the CobS protein be purified for biochemical characterization?

Based on the experimental approaches described in the research, CobS can be purified using affinity chromatography, particularly with histidine-tagged recombinant versions of the protein. The following method has been used successfully for CobS purification:

  • Express the cobS gene in an appropriate E. coli expression system (e.g., using vectors like pET-15b)

  • Add a histidine tag (His₆) to facilitate purification

  • Grow the recombinant cells and induce protein expression

  • Lyse the cells and prepare cell-free extract

  • Perform nickel affinity chromatography to capture the His-tagged CobS

  • Elute the purified protein with an imidazole gradient

  • Verify purity using SDS-PAGE and activity assays

It's worth noting that researchers have observed that CobS may not express at high levels visible on Coomassie-stained gels, but its activity can still be readily detected in biochemical assays .

What expression systems are optimal for producing recombinant CobS in E. coli?

For recombinant expression of CobS, the following systems have been demonstrated to be effective:

  • T7 Expression System: Vectors like pT7-7 and pET-15b have been used successfully for cobS expression .

  • Affinity-Tagged Systems: Adding a histidine tag (His₆) to the N-terminus or C-terminus of CobS facilitates purification. The pET system combined with BL21(DE3) E. coli strains provides a robust platform for controlled expression .

  • Induction Parameters: For T7-based systems, IPTG induction (typically 0.5-1.0 mM) at mid-log phase growth (OD₆₀₀ ~0.6-0.8) is commonly used, with induction times of 3-4 hours at 37°C or overnight at lower temperatures (16-25°C) to enhance protein solubility.

When designing expression constructs, researchers should consider codon optimization for E. coli if the source of the cobS gene is from a different organism with different codon usage patterns.

What factors affect the solubility and activity of recombinant CobS?

Several factors can impact the solubility and enzymatic activity of recombinant CobS:

  • Expression Temperature: Lower temperatures (16-25°C) during induction often increase the proportion of soluble protein by slowing down protein synthesis and folding.

  • Induction Duration and Intensity: Excessive overexpression can lead to inclusion body formation. Modulating IPTG concentration (0.1-1.0 mM) and induction time can help optimize soluble protein yield.

  • Media Composition: Rich media (like TB or 2YT) may support higher cell densities and protein yields compared to minimal media.

  • Co-expression with Chaperones: Co-expressing CobS with molecular chaperones (GroEL/GroES, DnaK/DnaJ/GrpE) can enhance proper folding and solubility.

  • Buffer Conditions: For purification and storage, buffer composition (pH, salt concentration, presence of stabilizing agents) significantly affects protein stability and activity.

  • Metal Ion Requirements: Many enzymes require specific metal ions for proper folding or catalytic activity. Including appropriate metal ions (e.g., Mg²⁺, Mn²⁺) in buffers may be necessary for optimal CobS activity.

What assays can be used to measure CobS enzymatic activity?

Several methods have been developed to assess CobS activity:

1. Radioisotope-Based Assays:

  • Incubate purified CobS with AdoCbi-GDP and radiolabeled α-ribazole-5′-P

  • Separate the products by chromatography

  • Quantify radioactive AdoCbl-5′-P by scintillation counting

2. HPLC-Based Analysis:

  • Perform the enzymatic reaction with purified components

  • Derivatize corrinoids with KCN to form cyanocobalamin derivatives

  • Separate products by reverse-phase HPLC

  • Detect and quantify using UV-visible spectroscopy (characteristic absorption at ~361 nm)

3. Growth Complementation Assays:

  • Incubate the reaction products with cobalamin auxotrophic strains (e.g., S. typhimurium JE212)

  • Measure growth promotion as an indicator of functional cobalamin synthesis

  • This serves as a biological verification of enzymatic activity

4. Spectrophotometric Methods:

  • Monitor changes in the characteristic UV-visible absorption spectrum of corrinoids during the reaction

  • This approach can be used for real-time monitoring of the reaction progress

How can researchers differentiate between CobS activity and other enzymes in the cobalamin biosynthesis pathway?

To specifically measure CobS activity and distinguish it from other enzymes in the pathway, researchers can employ the following strategies:

  • Purified Enzyme Assays: Use highly purified CobS protein with defined substrates (AdoCbi-GDP and α-ribazole-5′-P) to eliminate interference from other enzymes.

  • Specific Substrate Selection: Start the reaction with AdoCbi-GDP (product of CobU) and α-ribazole-5′-P (product of CobT) rather than earlier precursors to bypass the need for other enzymes.

  • Comparative Assays: Perform parallel reactions with extracts or purified enzymes from strains with and without the cobS gene to identify the specific contribution of CobS.

  • Selective Inhibition: Develop or utilize specific inhibitors that target CobS but not other enzymes in the pathway.

  • Product Identification: Use advanced analytical techniques (HPLC, mass spectrometry) to specifically identify the AdoCbl-5′-P product, which is unique to the CobS reaction .

How can site-directed mutagenesis be used to investigate the catalytic mechanism of CobS?

Site-directed mutagenesis is a powerful approach for investigating enzyme catalytic mechanisms. For CobS, researchers can:

  • Identify Conserved Residues: Perform sequence alignment of CobS proteins from different organisms to identify evolutionarily conserved amino acids that may be important for catalysis or substrate binding.

  • Target Specific Residues: Generate mutations in:

    • Predicted substrate binding sites for AdoCbi-GDP and α-ribazole-5′-P

    • Putative catalytic residues (typically charged or polar amino acids)

    • Structural elements that might contribute to enzyme conformation

  • Assess Mutant Phenotypes: Evaluate mutants for:

    • Changes in kinetic parameters (Km, kcat, kcat/Km)

    • Altered substrate specificity

    • Temperature or pH optimum shifts

    • Protein stability differences

  • Structural Validation: If structural data becomes available, correlate mutagenesis results with the three-dimensional structure to refine the catalytic model.

This approach would provide insights into the reaction mechanism and the specific residues involved in substrate recognition and catalysis.

What are the kinetic parameters of CobS and how can they be determined?

The kinetic parameters of CobS can be determined through steady-state kinetic analysis. Although specific values for E. coli CobS are not provided in the search results, the general methodology includes:

  • Initial Velocity Measurements:

    • Measure reaction rates at varying concentrations of substrates

    • Maintain enzyme concentration in the range where velocity is proportional to enzyme concentration

    • Ensure measurements are made in the linear range of the reaction

  • Determination of Km and Vmax:

    • For single-substrate analysis: Use Michaelis-Menten equation fitting

    • For bi-substrate reactions (as with CobS): Use appropriate models (ordered, random, ping-pong)

    • Plot data using Lineweaver-Burk, Eadie-Hofstee, or Hanes-Woolf transformations

    • Alternatively, use non-linear regression analysis

  • Calculation of kcat:

    • Determine kcat by dividing Vmax by the enzyme concentration

    • This provides the turnover number (catalytic efficiency)

  • Inhibition Studies:

    • Assess product inhibition patterns

    • Evaluate effects of structural analogs

    • These studies provide additional insights into the reaction mechanism

A typical experimental approach would involve varying one substrate concentration while keeping the other fixed, then repeating with different fixed concentrations of the second substrate.

How does CobS from E. coli O17:K52:H18 compare to CobS proteins from other organisms?

While the search results don't provide direct comparisons of CobS from E. coli O17:K52:H18 with other organisms, we can infer some comparative aspects:

  • Functional Conservation: The cobalamin biosynthesis pathway, including CobS function, is highly conserved among organisms that synthesize vitamin B12. The fundamental role of CobS in attaching the nucleotide loop appears to be consistent across species .

  • Comparison with Salmonella: Data from Salmonella typhimurium shows that CobS functions as a cobalamin-5′-phosphate synthase, which is likely similar in E. coli given the close evolutionary relationship between these bacteria .

  • Pathway Variations: While the core function is conserved, there may be variations in regulatory mechanisms, protein-protein interactions, or substrate specificity between different bacterial species.

Researchers interested in comparative analysis should consider sequence alignment, phylogenetic analysis, and functional complementation studies to better understand the evolutionary relationships and functional conservation of CobS proteins.

What is known about the regulation of cobS gene expression?

  • Operon Structure: In many bacteria, cobalamin biosynthesis genes are organized into operons. In Pseudomonas denitrificans, these genes are located in six different operons . The specific operon structure containing cobS in E. coli would influence its regulation.

  • Potential Regulatory Mechanisms:

    • Feedback inhibition by cobalamin or pathway intermediates

    • Transcriptional regulation in response to oxygen availability (some cobalamin biosynthesis pathways are oxygen-dependent)

    • Nutrient availability, particularly cobalt (essential for cobalamin)

  • Experimental Approaches: To study cobS regulation, researchers could:

    • Construct transcriptional or translational reporter fusions

    • Perform quantitative RT-PCR under various growth conditions

    • Use chromatin immunoprecipitation to identify regulatory proteins

    • Analyze the promoter region for regulatory elements

Understanding cobS regulation would provide insights into how bacteria control vitamin B12 production in response to environmental conditions.

What are common challenges in working with recombinant CobS and how can they be addressed?

Based on the research data and general recombinant protein experience, common challenges with CobS include:

1. Low Expression Levels:

  • CobS has been reported to express at levels not visible on Coomassie-stained gels

  • Solution: Optimize expression conditions (temperature, media, inducer concentration) or use stronger promoters/optimized codon usage

2. Protein Solubility Issues:

  • Solution: Express at lower temperatures (16-25°C), use solubility-enhancing fusion tags (MBP, SUMO), or add solubilizing agents to lysis buffer

3. Low Affinity Tag Binding:

  • Only 2.4% of total CobS activity bound to nickel columns in some experiments

  • Solution: Try alternative affinity tags or optimize binding conditions (buffer composition, imidazole concentration in binding buffer)

4. Enzyme Activity Stability:

  • Solution: Include stabilizing agents (glycerol, reducing agents, specific metal ions) in storage buffers and avoid freeze-thaw cycles

5. Assay Sensitivity:

  • Solution: Develop more sensitive detection methods or concentrate the enzyme preparation

6. Substrate Availability:

  • AdoCbi-GDP and α-ribazole-5′-P are specialized metabolites

  • Solution: Establish efficient synthesis routes for substrates or collaborate with specialized laboratories

How can the in vitro synthesis of cobalamin using recombinant CobS be optimized?

To optimize in vitro cobalamin synthesis using recombinant CobS, researchers should consider:

1. Multi-Enzyme Systems:

  • Reconstitute the complete pathway by including CobU, CobT, and CobC along with CobS

  • Adjust enzyme ratios to prevent bottlenecks in the reaction sequence

2. Reaction Conditions Optimization:

  • Determine optimal pH, temperature, ionic strength, and buffer composition

  • Identify cofactor requirements (likely including Mg²⁺ for GTP-utilizing reactions)

3. Substrate Concentrations:

  • Optimize concentrations of AdoCbi, GTP, DMB, and NaMN to ensure efficient conversion

  • Consider substrate feeding strategies for multi-step reactions

4. Oxygen Sensitivity:

  • Consider that while some organisms require oxygen for cobalamin synthesis, engineered E. coli can produce cobalamin under anaerobic conditions

  • Test both aerobic and anaerobic reaction conditions

5. Product Stabilization:

  • Include stabilizing agents for the cobalamin products

  • Develop efficient product isolation methods

6. Scale-Up Considerations:

  • Address potential inhibition by products or intermediates

  • Implement continuous product removal if necessary

The research shows that a complete in vitro system with all four enzymes (CobU, CobT, CobS, and CobC) successfully converted adenosylcobinamide to adenosylcobalamin, offering a foundation for further optimization .

How should CobS activity data be analyzed and presented in research publications?

For comprehensive analysis and presentation of CobS activity data, researchers should consider:

1. Enzyme Kinetic Analysis:

  • Present Michaelis-Menten plots for both substrates

  • Include calculated kinetic parameters (Km, Vmax, kcat, kcat/Km) with appropriate error ranges

  • Consider using table format for clarity:

Table 1: Kinetic Parameters of Recombinant E. coli CobS

ParameterAdoCbi-GDPα-Ribazole-5′-PUnits
Km[value][value]μM
Vmax[value][value]nmol/min/mg
kcat[value][value]s⁻¹
kcat/Km[value][value]M⁻¹s⁻¹

2. Activity Measurements:

  • Present specific activity values clearly (e.g., "Extracts from cells carrying plasmids pNLA1 (cobUST+) or pCOBS4 (cobS+) contained cobalamin synthase with specific activities of 22 or 8 nmol of product per min per mg of protein, respectively")

  • Include comparative analyses between wild-type and mutant enzymes if applicable

3. Chromatographic Analysis:

  • Show representative HPLC chromatograms with clear labeling of peaks

  • Include retention times of standards and samples

  • Present UV-visible spectra of isolated products

4. Product Verification:

  • Include mass spectrometry data for product identification

  • Present growth complementation results for functional verification

  • Quantify product yields under various conditions

5. Statistical Analysis:

  • Apply appropriate statistical tests to demonstrate significance

  • Include error bars and p-values where relevant

  • Perform replicates (minimum triplicate) for all key measurements

What methodological controls are essential when characterizing recombinant CobS activity?

When characterizing recombinant CobS activity, the following controls are essential:

1. Negative Controls:

  • Extracts from cells carrying the expression vector without the cobS gene

  • Reaction mixtures without enzyme

  • Reaction mixtures with heat-inactivated enzyme

  • Reactions missing one or more substrates

2. Positive Controls:

  • Known active preparations of CobS or related enzymes

  • Complete pathway reconstitution with all four enzymes (CobU, CobT, CobS, CobC)

3. Substrate Controls:

  • Purity verification of substrates (AdoCbi-GDP, α-ribazole-5′-P)

  • Stability controls for substrates under reaction conditions

4. Product Verification:

  • HPLC analysis with authentic standards

  • UV-visible spectroscopy comparison with known spectra

  • Mass spectrometry confirmation

  • Biological activity verification (e.g., growth complementation assays)

5. Specificity Controls:

  • Testing structural analogs of substrates

  • Evaluating cross-reactivity with related enzymes

6. Technical Controls:

  • Enzyme concentration linearity check

  • Time-course analysis to ensure measurements in linear range

  • Buffer composition controls (e.g., metal ions, reducing agents)

Implementation of these controls ensures reliable and reproducible characterization of CobS activity and helps in troubleshooting when unexpected results occur.

What are the key challenges and opportunities in CobS research?

Current Challenges:

  • Structural Characterization: Limited structural information is available for CobS, hindering a complete understanding of its catalytic mechanism.

  • Low Expression Levels: CobS has been reported to express at levels not visible on Coomassie-stained gels, complicating purification and characterization .

  • Substrate Availability: The specialized substrates (AdoCbi-GDP, α-ribazole-5′-P) are not commercially available, requiring additional synthetic steps or enzymatic preparation.

  • Mechanistic Understanding: The detailed catalytic mechanism, including the order of substrate binding and product release, remains to be fully elucidated.

Future Opportunities:

  • Structural Biology: Determining the three-dimensional structure of CobS through X-ray crystallography or cryo-EM would provide insights into substrate binding and catalysis.

  • Pathway Engineering: Optimizing the complete cobalamin biosynthetic pathway in E. coli could enable efficient production of vitamin B12 or analogs .

  • Synthetic Biology Applications: Engineered CobS variants might catalyze the attachment of novel nucleotide loops, creating cobalamin analogs with modified properties.

  • Comparative Enzymology: Studying CobS from diverse organisms could reveal evolutionary adaptations and potentially identify variants with superior catalytic properties.

How might research on CobS contribute to broader fields such as metabolic engineering and synthetic biology?

Research on CobS has significant implications for several broader fields:

1. Metabolic Engineering for Vitamin B12 Production:

  • E. coli has been engineered to produce coenzyme B12, with yields of up to 0.65 ± 0.03 μg/g cell dry weight

  • Understanding and optimizing CobS activity could remove bottlenecks in this pathway

  • The ability of engineered E. coli to produce cobalamin under anaerobic conditions offers unique production opportunities

2. Synthetic Biology Applications:

  • The nucleotide loop assembly pathway provides modules for synthetic biology

  • CobS could be used to create novel cobamides with modified lower ligands

  • Engineered cobamide-dependent enzymes might have applications in biocatalysis

3. Evolutionary Biology Insights:

  • The complex B12 biosynthesis pathway, including CobS, provides a model system for studying the evolution of complex metabolic pathways

  • Comparative analysis across species can reveal evolutionary patterns in enzyme function

4. Biomedical Applications:

  • Understanding B12 biosynthesis could inform approaches to vitamin deficiency

  • Novel cobamide analogs might have therapeutic applications

  • The pathway might serve as a target for antimicrobial development in pathogenic bacteria

5. Systems Biology Approach:

  • Integration of CobS into models of bacterial metabolism

  • Understanding regulatory networks controlling vitamin synthesis

  • Elucidating metabolic interactions between B12 production and other cellular processes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.