Recombinant Escherichia coli O17:K52:H18 Electron transport complex protein RnfE (rnfE)

Shipped with Ice Packs
In Stock

Description

Biological Role of the Rnf Complex

The Rnf complex in E. coli O17:K52:H18 is part of a conserved ion-translocating electron transport chain critical for:

  • Energy Conservation: Couples electron transfer from reduced ferredoxin to NAD+ with Na+ translocation, generating a sodium motive force for ATP synthesis .

  • Pathogenicity: Rnf homologs in extraintestinal pathogenic E. coli (ExPEC) strains like O17:K52:H18 enhance survival in low-oxygen environments (e.g., urinary tract), contributing to asymptomatic bacteriuria and persistent infections .

Functional Domains in RnfE:

  • Fe-S Clusters: Facilitate electron transfer .

  • Transmembrane Helices: Anchor the protein to the cytoplasmic membrane .

Expression and Purification:

  • Vector: Full-length rnfE gene cloned into E. coli expression systems .

  • Storage: Tris-based buffer with 50% glycerol; stable at -20°C/-80°C .

Research Applications:

ApplicationUse CaseSource
ELISAQuantifying RnfE in bacterial lysates or clinical samples
Western BlotDetecting RnfE expression in pathogenicity studies
Structural StudiesInvestigating Na+ translocation mechanisms

Genetic and Epidemiological Context

  • Strain Virulence: E. coli O17:K52:H18 is a multidrug-resistant ExPEC clone associated with urinary tract infections (UTIs) and bacteremia. Its Rnf complex may aid in colonization under oxidative stress .

  • Genomic Island Association: The rnf operon in O17:K52:H18 is often flanked by mobile genetic elements, suggesting horizontal gene transfer .

Comparative Serotype Data:

SerotypeClinical RelevanceRnf Complex Presence
O15:K52:H1Pyelonephritis, community-acquired UTIsYes
O17:K52:H18Asymptomatic bacteriuria, hospital-acquiredYes
O2:K5:H4Neonatal meningitisNo

Research Gaps and Future Directions

  • Mechanistic Studies: How RnfE’s Na+ translocation contributes to E. coli O17:K52:H18’s resilience in hostile host environments.

  • Therapeutic Targeting: Potential for disrupting Rnf complex activity to mitigate antibiotic-resistant infections .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will fulfill your request as best as possible.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery details.
Note: Our proteins are shipped standard with blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
rsxE; ECUMN_1923; Ion-translocating oxidoreductase complex subunit E; Rsx electron transport complex subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-231
Protein Length
full length protein
Species
Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Target Names
rsxE
Target Protein Sequence
MSEIKDVIVQGLWKNNSALVQLLGLCPLLAVTSTATNALGLGLATTLVLTLTNLTISTLR HWTPAEIRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAA KKGPALSALDGFSIGMGATCAMFVLGSLREIIGNGTLFDGADALLGSWAKVLRVEIFHTD SPFLLAMLPPGAFIGLGLMLAGKYLIDERMKKRRAEAAAERALPNGETGNV
Uniprot No.

Target Background

Function
RnfE is a component of a membrane-bound complex that couples electron transfer with ion translocation across the membrane. It is essential for maintaining the reduced state of SoxR.
Database Links
Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does RnfE function within the electron transport complex of E. coli O17:K52:H18?

The RnfE protein functions as a component of the electron transport complex in E. coli O17:K52:H18. As indicated by its recommended name (Electron transport complex protein RnfE), this protein participates in electron transfer processes that are essential for cellular respiration and energy metabolism. The protein contains multiple transmembrane domains, as evidenced by its hydrophobic amino acid sequences, which facilitate its integration into the cell membrane where electron transport processes occur. The specific electron transfer mechanisms involving RnfE require further characterization through experimental approaches such as site-directed mutagenesis and electron transport assays to elucidate its precise role in the respiratory chain of this bacterial strain .

What are the optimal storage conditions for maintaining RnfE protein stability during experimental procedures?

For optimal stability of the Recombinant Escherichia coli O17:K52:H18 Electron transport complex protein RnfE, researchers should store the protein at -20°C, with extended storage recommended at -20°C or -80°C. The protein is typically supplied in a Tris-based buffer containing 50% glycerol, which has been optimized for this specific protein. To minimize protein degradation, repeated freeze-thaw cycles should be avoided, as these can compromise structural integrity and biological activity. For short-term experimental procedures (up to one week), working aliquots may be stored at 4°C. This approach ensures that the protein maintains its native conformation and functional properties throughout the experimental timeline .

How should researchers design experiments to investigate RnfE function using variable manipulation approaches?

When designing experiments to investigate RnfE function, researchers should follow a systematic experimental design framework:

  • Define clear research questions and testable hypotheses about RnfE function

  • Identify independent variables (e.g., expression levels of RnfE, mutation sites, environmental conditions) and dependent variables (e.g., electron transport rates, growth rates, membrane potential)

  • Control for extraneous variables that might influence results

The experimental approach should incorporate:

Independent Variable Manipulation: Systematically vary RnfE expression levels, introduce site-directed mutations at conserved domains, or alter environmental conditions (pH, temperature, oxygen availability) to assess functional implications .

Experimental Groups:

  • Control group: Wild-type E. coli O17:K52:H18 with native RnfE expression

  • Experimental groups: RnfE knockout, RnfE overexpression, RnfE with specific domain mutations

Measurement Parameters:

  • Electron transport rates

  • Membrane potential

  • Growth kinetics under different respiratory conditions

  • Protein-protein interactions with other electron transport components

Researchers should ensure random distribution of samples to minimize bias and employ appropriate statistical analyses to establish causality between RnfE modifications and observed phenotypic changes .

How do recombination and mutation events contribute to the evolution of electron transport proteins like RnfE in pathogenic E. coli strains?

The evolution of electron transport proteins like RnfE in pathogenic E. coli strains involves both recombination and mutation events, with significant implications for bacterial adaptation. Based on comparative analyses of E. coli evolutionary patterns, recombination events can introduce substantial genetic variation in a single event compared to point mutations. For instance, in the evolution of E. coli O157:H7 from O55:H7, 67 recombination events introduced 5,048 base changes, while mutation accounted for 3,763 SNPs .

For electron transport proteins like RnfE, evolutionary changes may include:

  • Mutational changes: Synonymous and non-synonymous substitutions that accumulate gradually

  • Recombination events: Replacement of gene segments or entire clusters that may rapidly alter function

  • Horizontal gene transfer: Acquisition of novel electron transport components from different bacterial species

The rate of these evolutionary changes appears strain-dependent, with some pathogenic lineages showing accelerated mutation rates. For example, the O157:H7 lineage demonstrated approximately 50% more synonymous substitutions compared to O55:H7, suggesting potentially faster evolution of proteins including those in electron transport systems .

To investigate the evolutionary history of RnfE specifically, researchers should employ comparative genomic approaches to:

  • Analyze synonymous substitution rates to estimate divergence times

  • Identify recombination events through SNP distribution patterns

  • Characterize selection pressures acting on different protein domains

These approaches could reveal how evolutionary processes have shaped the function of RnfE in different E. coli pathotypes and its potential contribution to pathogenicity.

What methodological approaches are most effective for studying protein-protein interactions involving RnfE in the electron transport complex?

When investigating protein-protein interactions involving RnfE in the electron transport complex, researchers should employ a multi-method approach that combines complementary techniques:

In vitro methods:

  • Co-immunoprecipitation (Co-IP): Using antibodies against RnfE to isolate protein complexes, followed by mass spectrometry to identify interaction partners

  • Surface Plasmon Resonance (SPR): Measuring real-time binding kinetics between purified RnfE and candidate interaction partners

  • Isothermal Titration Calorimetry (ITC): Quantifying thermodynamic parameters of RnfE interactions

In vivo methods:

  • Bacterial Two-Hybrid System: Adapted for membrane proteins to detect interactions in a cellular context

  • Fluorescence Resonance Energy Transfer (FRET): Using fluorescently tagged RnfE and potential partners to visualize interactions in living bacteria

  • Cross-linking Mass Spectrometry: Capturing transient interactions within the native membrane environment

Computational approaches:

  • Molecular Docking: Predicting interaction interfaces based on the RnfE amino acid sequence

  • Coevolution Analysis: Identifying coevolving residues that may indicate interaction surfaces

When designing these experiments, researchers should carefully control for the hydrophobic nature of membrane proteins like RnfE, potentially using specialized detergents or nanodiscs to maintain protein stability while preserving interaction capabilities. The experimental design should include appropriate negative controls and validation across multiple methods to confirm genuine interactions .

How should researchers interpret contradictory data when analyzing RnfE function in different experimental systems?

When faced with contradictory data regarding RnfE function across different experimental systems, researchers should implement a systematic analytical approach:

  • Evaluate Experimental Design Differences:

    • Compare independent and dependent variables between studies

    • Assess control groups and their appropriateness

    • Examine randomization procedures and potential selection biases

  • Analyze Methodological Variations:

    • Protein expression systems (heterologous vs. native)

    • Purification procedures and their impact on protein conformation

    • Assay conditions (pH, temperature, buffer composition)

  • Consider Biological Context:

    • Growth phase differences between experiments

    • Media composition variations

    • Strain-specific genetic backgrounds that may influence RnfE function

  • Statistical Reassessment:

    • Review statistical methods employed

    • Evaluate sample sizes and power calculations

    • Consider performing meta-analysis when multiple datasets are available

  • Reconciliation Strategies:

    • Develop testable hypotheses that could explain observed contradictions

    • Design experiments specifically to address inconsistencies

    • Consider system-specific factors that might explain divergent results

When reporting contradictory findings, researchers should present all relevant data in a structured format, potentially using comparative tables that highlight methodological differences, key findings, and proposed explanations for observed discrepancies. This approach promotes transparent scientific communication and facilitates ongoing refinement of our understanding of RnfE function.

What statistical approaches are most appropriate for analyzing electron transport activity data involving RnfE?

When analyzing electron transport activity data involving RnfE, researchers should select statistical approaches based on experimental design complexity and data characteristics:

  • For Comparison Between Treatment Groups:

    • Independent samples t-test: When comparing two experimental conditions (e.g., wild-type vs. RnfE knockout)

    • One-way ANOVA with post-hoc tests: When comparing multiple experimental conditions (e.g., wild-type, RnfE knockout, RnfE point mutations)

    • Two-way ANOVA: When examining interactions between two factors (e.g., RnfE expression levels and environmental conditions)

  • For Time-Course Experiments:

    • Repeated measures ANOVA: When measuring electron transport activity at multiple time points

    • Mixed-effects models: When accounting for both fixed effects (experimental treatments) and random effects (individual culture variations)

  • For Dose-Response Relationships:

    • Regression analysis: Linear or non-linear regression to determine relationship between RnfE concentration and electron transport metrics

    • EC50 determination: Calculating half-maximal effective concentrations for RnfE activity

  • For Complex Multi-Variable Experiments:

    • Multivariate analysis: Principal Component Analysis (PCA) or Factor Analysis to identify patterns in complex datasets

    • Multiple regression models: To assess contributions of multiple variables to electron transport activity

The experimental design determines the appropriate statistical approach, as highlighted in experimental design literature. Researchers should ensure proper randomization of experimental units, adequate sample sizes based on power calculations, and appropriate controls for confounding variables .

Data presentation should include both visual representations (graphs showing means with error bars indicating standard deviations or standard errors) and numerical summaries (tables with descriptive statistics). Statistical significance should be reported with exact p-values alongside effect sizes to provide a complete understanding of both statistical and biological significance.

How does RnfE from E. coli O17:K52:H18 compare structurally and functionally to homologous proteins in other bacterial species?

Comparative analysis of RnfE from E. coli O17:K52:H18 with homologous proteins in other bacterial species reveals important structural and functional insights. The RnfE protein (UniProt ID: B7NB86) contains transmembrane domains characteristic of electron transport components, with 231 amino acids forming its full-length structure .

Structural Comparison Methodology:

  • Sequence alignment of E. coli O17:K52:H18 RnfE with homologs from diverse bacterial species

  • Identification of conserved domains and critical residues

  • Prediction of secondary and tertiary structures

  • Comparative analysis of transmembrane topology

Functional Comparison Approaches:

  • Assessment of electron transport capabilities using standardized assays

  • Evaluation of complementation ability in cross-species knockout studies

  • Characterization of substrate specificity differences

  • Examination of regulatory mechanisms across species

Researchers should employ both computational (sequence analysis, structural prediction) and experimental (heterologous expression, functional assays) approaches to comprehensively understand the evolutionary conservation and diversification of RnfE function across bacterial species. This comparative analysis provides context for understanding RnfE's specific role in E. coli O17:K52:H18 pathogenicity and metabolism.

What are the key methodological considerations when comparing recombination versus mutation rates in the evolution of electron transport proteins like RnfE?

When comparing recombination versus mutation rates in the evolution of electron transport proteins like RnfE, researchers must consider several methodological aspects:

Researchers should combine these methodological approaches with appropriate bioinformatic tools and statistical frameworks to accurately characterize the evolutionary dynamics of electron transport proteins like RnfE. This integrated approach provides deeper insights into the relative contributions of different evolutionary mechanisms to protein diversification.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.