Recombinant Escherichia coli O17:K52:H18 Fumarate reductase subunit C (frdC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a specific tag, please inform us; we will prioritize its implementation.
Synonyms
frdC; ECUMN_4688; Fumarate reductase subunit C; Fumarate reductase 15 kDa hydrophobic protein; Quinol-fumarate reductase subunit C; QFR subunit C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-131
Protein Length
full length protein
Species
Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Target Names
frdC
Target Protein Sequence
MTTKRKPYVRPMTSTWWKKLPFYRFYMLREGTAVPAVWFSIELIFGLFALKNGPESWAGF VDFLQNPVIVIINLITLAAALLHTKTWFELAPKAANIIVKDEKMGPEPIIKSLWAVTVVA TIVILFVALYW
Uniprot No.

Target Background

Function

Two distinct, membrane-bound, FAD-containing enzymes catalyze the interconversion of fumarate and succinate. Fumarate reductase is utilized during anaerobic growth, while succinate dehydrogenase functions in aerobic growth. The FrdC subunit anchors the catalytic components of the fumarate reductase complex to the inner cell membrane and binds quinones.

Database Links
Protein Families
FrdC family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structural composition of frdC in E. coli O17:K52:H18?

Fumarate reductase subunit C (frdC) from E. coli O17:K52:H18 is a 15 kDa hydrophobic membrane protein comprising 131 amino acid residues. The protein sequence begins with MTTRKPYVRPMTSTWWKKLPFYRFYMLREGTAVPAVWFSIELIFGLFALKNGPESWAGFVDFLQNPVIVIINLITLAAALLHTKTWFELAPKAANIIVKDEKMGPEPIIKSLWAVTVVATIVILFVALYW . This protein functions as an integral membrane component of the fumarate reductase complex, which plays a crucial role in anaerobic respiration. The subunit contains highly hydrophobic regions that anchor the entire fumarate reductase complex to the membrane.

How does frdC contribute to the electron transport mechanism?

FrdC serves as a critical component in the transmembrane electron transfer pathway during anaerobic respiration. It works in conjunction with the diheme groups to facilitate electron transfer from quinol to fumarate. Recent research demonstrates that this electron transfer is coupled to proton cotransfer through a transiently established pathway . This coupling mechanism is essential for energy conservation during anaerobic respiration, allowing bacteria to utilize fumarate as a terminal electron acceptor when oxygen is unavailable.

What mutagenesis techniques are most effective for studying frdC function?

Site-directed mutagenesis using complementary primer pairs has proven highly effective for studying frdC function. As demonstrated in research with the related Wolinella succinogenes fumarate reductase, the QuikChange site-directed mutagenesis kit (Stratagene) can be used with specifically synthesized complementary primer pairs to create targeted mutations like E180Q and E180I . The research methodology involves:

  • Design of specific primers with altered nucleotides to introduce the desired mutation

  • PCR amplification using the template plasmid containing the wildtype gene

  • Confirmation of mutations through sequencing of PCR products

  • Expression of the mutant protein for functional characterization

This approach allows for precise modification of key residues to examine their role in protein function and electron transport mechanisms.

How should researchers optimize the expression and purification of recombinant frdC?

Due to the hydrophobic nature of frdC, expression and purification require specialized approaches:

StepMethodologyKey Considerations
Expression SystemUse of specialized E. coli strains designed for membrane protein expressionAvoid toxic effects by using controlled induction systems
Growth ConditionsCultivation at lower temperatures (16-25°C) after inductionReduces inclusion body formation common with membrane proteins
SolubilizationUse of mild detergents (e.g., Triton X-100)Critical for maintaining protein structure and function
PurificationAffinity chromatography followed by size exclusionTag placement must not interfere with membrane insertion
Storage50% glycerol in Tris-based buffer at -20°C or -80°CAvoids repeated freeze-thaw cycles that can denature the protein

When expressing recombinant frdC, researchers should note that proper folding and membrane insertion are critical challenges. The use of specialized expression hosts and careful optimization of induction conditions can significantly improve yields of functional protein.

How do mutations in key residues affect frdC activity and what methods best detect these changes?

Mutations in key residues of frdC can dramatically alter protein function as demonstrated by studies on homologous proteins. Research on Wolinella succinogenes fumarate reductase showed that replacement of Glu-C180 with Gln or Ile resulted in mutants unable to grow on fumarate, with membrane-bound variant enzymes lacking quinol oxidation activity .

Methods for detecting functional changes include:

  • Growth assays using different electron acceptors (e.g., fumarate vs. nitrate)

  • Enzymatic activity measurements comparing wildtype and mutant proteins

  • Spectroscopic methods to monitor electron transfer rates

  • X-ray crystallography to detect structural changes at 2.19-2.76 Å resolution

  • Measurement of oxidation-reduction heme midpoint potential changes

Results from such analyses have revealed that deprotonation of key residues like Glu-C180 facilitates the reoxidation of reduced high-potential heme, and comparison of solvent isotope effects can indicate rate-limiting proton transfer steps .

What analytical methods are most informative for studying frdC structure-function relationships?

For comprehensive structure-function analysis of frdC, researchers should employ multiple complementary approaches:

  • X-ray Crystallography: Provides high-resolution structural data, crucial for identifying spatial relationships between key residues. Successful structures have been refined at resolutions of 2.19-2.76 Å .

  • Electron Paramagnetic Resonance (EPR): Particularly valuable for studying the redox states of the heme groups associated with frdC.

  • Site-Directed Mutagenesis coupled with Activity Assays: Enables determination of functional roles of specific residues. For example, mutations of Glu-C180 resulted in dramatic changes in quinol oxidation activity .

  • Solvent Isotope Effect Analysis: Can identify rate-limiting proton transfer steps in the reaction mechanism. Studies have shown that rate-limiting proton transfer steps in wildtype enzymes may be lost in variants like Glu-C180 → Gln .

  • Membrane Potential Measurements: Important for understanding the bioenergetic role of frdC in coupling electron and proton transfer.

How does the E pathway hypothesis explain the coupling of electron and proton transfer in frdC-containing complexes?

The E pathway hypothesis provides a mechanistic framework for understanding how electron transfer via heme groups is coupled to proton transfer in dihemic quinol:fumarate reductase. According to this model:

  • Transmembrane electron transfer via the heme groups is strictly coupled to cotransfer of protons

  • A transiently established pathway containing the side chain of residue Glu-C180 serves as the most prominent component

  • Deprotonation of Glu-C180 facilitates the reoxidation of the reduced high-potential heme

Experimental evidence supporting this hypothesis includes:

  • Mutants where Glu-C180 is replaced with Gln or Ile are unable to grow on fumarate

  • Membrane-bound variant enzymes lack quinol oxidation activity

  • Upon solubilization, the purified enzymes display approximately 1/10 of the specific quinol oxidation activity of the wild-type enzyme

  • X-ray crystal structures rule out major structural changes as the cause of activity loss

This hypothesis has significant implications for understanding energy conservation mechanisms in anaerobic respiratory chains and the evolution of proton-pumping complexes.

What are the technical challenges in distinguishing direct and indirect effects of frdC mutations?

Distinguishing direct from indirect effects of frdC mutations presents several technical challenges:

  • Structural Perturbations vs. Functional Impacts: Mutations may cause subtle structural changes that propagate through the protein complex. High-resolution structural techniques (X-ray crystallography at resolutions better than 2.2 Å) are required to detect these changes .

  • Membrane Environment Effects: The behavior of membrane proteins like frdC differs dramatically between membrane-bound and solubilized states. Research has shown that some mutations abolish activity in membrane-bound enzymes but retain partial activity when solubilized .

  • Coupled Reactions: Electron transfer and proton translocation are tightly coupled processes. Specialized techniques like:

    • Solvent isotope effect measurements

    • Membrane potential-sensitive probes

    • Time-resolved spectroscopy
      are needed to deconvolute these processes.

  • Allosteric Effects: Mutations at one site may affect function at distant sites through allosteric mechanisms. Computational approaches like molecular dynamics simulations can help identify these networks.

How can researchers integrate structural, biochemical, and biophysical approaches to develop comprehensive models of frdC function?

Developing comprehensive models of frdC function requires integration of multiple experimental approaches:

  • Structural Biology: X-ray crystallography and cryo-electron microscopy provide atomic-level insights into protein architecture. Successful structure determination has been achieved at resolutions of 2.19-2.76 Å, allowing visualization of key residues like Glu-C180 .

  • Mutagenesis and Functional Assays: Systematic mutation of conserved residues coupled with activity measurements helps identify functionally important sites. The QuikChange site-directed mutagenesis approach has been effectively used for introducing specific mutations .

  • Biophysical Characterization: Techniques including EPR spectroscopy, potentiometric titrations, and protein film voltammetry provide insights into electron transfer processes.

  • Computational Modeling: Molecular dynamics simulations and quantum mechanical/molecular mechanical (QM/MM) calculations help predict proton and electron transfer pathways.

  • Evolutionary Analysis: Comparative genomics to identify conserved residues across species can highlight functionally critical regions.

An integrated approach has successfully elucidated the E pathway hypothesis, demonstrating how Glu-C180 plays a crucial role in coupling electron transfer through heme groups with proton translocation .

How can frdC serve as a model system for understanding membrane protein complexes involved in bioenergetics?

Fumarate reductase subunit C (frdC) serves as an excellent model system for understanding membrane protein complexes involved in bioenergetics for several reasons:

  • Structural Simplicity with Functional Complexity: With only 131 amino acids , frdC is relatively small compared to many membrane proteins, yet it plays a crucial role in the complex process of electron and proton transfer.

  • Well-Characterized Mutations: Studies have demonstrated clear phenotypic effects of specific mutations, such as the E180Q and E180I variants that abolish growth on fumarate .

  • Established Crystallization Protocols: The ability to obtain high-resolution crystal structures (2.19-2.76 Å) makes frdC an accessible model for structural biology approaches to membrane protein research .

  • Evolutionary Conservation: Fumarate reductases are widely distributed across prokaryotes, making frdC valuable for comparative studies of respiratory chain evolution.

  • Measurable Functional Outputs: Both growth phenotypes and enzymatic activities provide clear readouts of functional effects, facilitating structure-function correlations.

The insights gained from frdC research have broader implications for understanding proton-coupled electron transfer in respiratory complexes, ATP synthases, and other bioenergetic systems.

What insights does frdC research provide about bacterial adaptation to different environmental conditions?

Research on frdC provides critical insights into bacterial adaptation to varying environmental conditions:

  • Oxygen Availability Adaptation: Fumarate reductase allows bacteria to utilize alternative electron acceptors (fumarate) when oxygen is limited, demonstrating metabolic flexibility.

  • Energy Conservation Strategies: The coupled electron-proton transfer mechanisms revealed through E pathway studies illustrate how bacteria maximize energy conservation under anaerobic conditions .

  • Membrane Architecture Adaptation: The structure-function relationships in frdC reveal how membrane protein architecture enables specific bioenergetic processes in different environments.

  • Evolutionary Conservation vs. Specialization: Comparison of frdC across bacterial species reveals both conserved mechanisms and species-specific adaptations to particular ecological niches.

  • Metabolic Integration: frdC research demonstrates how membrane protein complexes integrate with central metabolism, allowing bacteria to thrive in diverse environments by coupling quinol oxidation to fumarate reduction.

The insights gained from frdC research contribute to our understanding of how bacteria adapt their respiratory chains to survive in environments with fluctuating oxygen availability, which has implications for both ecological studies and applications in biotechnology and medicine.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.