Recombinant Escherichia coli O17:K52:H18 Fumarate reductase subunit D (frdD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
frdD; ECUMN_4687; Fumarate reductase subunit D; Fumarate reductase 13 kDa hydrophobic protein; Quinol-fumarate reductase subunit D; QFR subunit D
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Target Names
frdD
Target Protein Sequence
MINPNPKRSDEPVFWGLFGAGGMWSAIIAPVMILLVGILLPLGLFPGDALSYERVLAFAQ SFIGRVFLFLMIVLPLWCGLHRMHHAMHDLKIHVPAGKWVFYGLAAILTVVTLIGVVTI
Uniprot No.

Target Background

Function

Two distinct, membrane-bound, FAD-containing enzymes catalyze the interconversion of fumarate and succinate. Fumarate reductase is utilized during anaerobic growth, while succinate dehydrogenase functions in aerobic growth. FrdD anchors the catalytic components of the fumarate reductase complex to the inner cell membrane and binds quinones.

Database Links
Protein Families
FrdD family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the fumarate reductase complex in E. coli and what role does the FrdD subunit play?

Fumarate reductase (FRD) in Escherichia coli functions as a four-subunit membrane-bound complex that is specifically synthesized during anaerobic growth conditions when fumarate serves as a terminal electron acceptor. The complex consists of two major functional components: a catalytic domain composed of FrdA and FrdB subunits, and a membrane anchor domain comprising the FrdC and FrdD subunits. The FrdD subunit, along with FrdC, plays a crucial role in anchoring the catalytic domain to the cytoplasmic membrane surface. More importantly, these small hydrophobic polypeptides are essential for the enzyme's interaction with quinones, which serve as electron carriers in the respiratory chain .

Research has demonstrated that FrdD contains multiple transmembrane helices that contribute to the structural integrity of the complex and participate in forming quinone binding sites. Experimental evidence from mutagenesis studies indicates that alterations in the FrdD structure can significantly impair the enzyme's ability to oxidize physiological electron donors such as menaquinol-6 in the presence of fumarate .

How does the structure of FrdD relate to its function in the fumarate reductase complex?

The FrdD subunit contains multiple transmembrane helices that integrate into the cytoplasmic membrane of E. coli, providing essential structural support for the entire fumarate reductase complex. The transmembrane organization of FrdD is critical for proper complex formation and quinone interaction. Mutagenesis studies have shown that premature termination in FrdD resulting in the loss of one or more predicted transmembrane helices leads to compromised function of the entire complex .

Structurally, FrdD works in concert with FrdC to create the membrane anchor domain that positions the catalytic subunits (FrdA and FrdB) appropriately at the membrane surface. This positioning is essential for the electron transfer pathway from menaquinol to fumarate. The hydrophobic nature of FrdD is particularly important for creating the environment necessary for quinone binding. Evidence suggests that the FrdD subunit contributes to the formation of at least one of the two quinone binding sites identified in the fumarate reductase complex, enabling the two-step electron transfer process that characterizes the enzyme's activity .

What mutagenesis approaches are most effective for studying FrdD function?

For investigating FrdD function, selective mutagenesis of the frdCD genes has proven highly effective. Based on published methodologies, a systematic approach combining site-directed mutagenesis and random mutagenesis provides comprehensive insights into structure-function relationships. The most successful protocol involves:

  • Targeted deletion mutagenesis: Creating single base deletions that cause premature termination in FrdD, resulting in the loss of one or more transmembrane helices.

  • Site-directed mutagenesis: Introducing single base changes resulting in specific amino acid substitutions to identify critical residues.

  • Phenotypic screening: Identifying Frd⁻ strains by their inability to grow on restrictive media lacking alternative electron acceptors .

For optimal results, researchers should isolate the resulting mutant FRD complexes and characterize them biochemically through electron transfer assays. This approach has revealed that mutant enzyme complexes with altered FrdD structure are incapable of oxidizing menaquinol-6 in the presence of fumarate, confirming the essential role of FrdD in quinone interaction .

A complementary approach involves analyzing the separation of oxidative and reductive activities with quinones, which has provided evidence for two distinct quinone binding sites in the fumarate reductase complex, suggesting that electron transfer occurs in two one-electron steps at these separate sites .

What are the most reliable methods for isolating and purifying recombinant FrdD for in vitro studies?

For reliable isolation and purification of recombinant FrdD from E. coli O17:K52:H18, a multi-step protocol has been established based on published methodologies:

Table 1: Optimized Protocol for FrdD Isolation and Purification

StepProcedureCritical ParametersExpected Outcome
1Anaerobic cultureGrowth with fumarate as terminal electron acceptorMaximum FRD complex expression
2Membrane fraction isolationLow-speed centrifugation followed by ultracentrifugationEnrichment of membrane-bound FRD
3Detergent solubilization1% n-dodecyl-β-D-maltoside, pH 7.2Solubilization of intact FRD complex
4Affinity chromatographyHistidine-tagged constructs with Ni-NTA resinInitial purification
5Size exclusion chromatographySuperdex 200 columnSeparation of intact complex from free subunits
6Activity verificationMenaquinol oxidation assayConfirmation of functional integrity

For studies requiring isolated FrdD subunit, denaturing conditions must be carefully optimized to separate the subunit while maintaining structural elements critical for subsequent functional studies. Researchers should note that isolated FrdD tends to aggregate due to its hydrophobic nature, necessitating the use of appropriate detergents throughout the purification process .

How does the quinone binding mechanism of FrdD differ from that of FrdC, and what are the implications for electron transfer?

The quinone binding mechanisms of FrdD and FrdC represent a complex interplay that facilitates electron transfer in the fumarate reductase system. Based on mutational studies, FrdD appears to contribute to a distinct quinone binding site separate from that formed by FrdC. This separation of binding sites has profound implications for the electron transfer mechanism.

This differential effect on oxidative versus reductive activities supports the model where:

  • FrdD primarily contributes to the binding site involved in menaquinol oxidation

  • FrdC contributes more significantly to the site involved in ubiquinone reduction

  • Both subunits create a coordinated electron transfer pathway that connects the membrane domain with the catalytic domain

The functional significance of this arrangement lies in allowing precise control over the directional flow of electrons from menaquinol to fumarate, a critical aspect of anaerobic respiration in E. coli.

What role does FrdD play in the assembly and stability of the fumarate reductase complex?

FrdD serves as a critical structural component that influences both the assembly process and long-term stability of the fumarate reductase complex. Investigation of mutant strains has revealed several key aspects of FrdD's contribution:

  • Complex Assembly: Premature termination mutations in FrdD that result in the loss of transmembrane helices significantly impair the assembly of the complete fumarate reductase complex. This suggests that FrdD provides essential interaction surfaces that guide the proper folding and association of the four subunits .

  • Membrane Integration: FrdD, in conjunction with FrdC, ensures proper embedding of the complex in the cytoplasmic membrane. This correct positioning is critical for the complex to access both its substrate (fumarate) and electron donor (menaquinol) .

  • Structural Stability: The transmembrane helices of FrdD appear to provide lateral stability within the membrane, preventing unfolding or disassociation of the complex under varying physiological conditions.

  • Catalytic Domain Orientation: FrdD helps position the catalytic FrdA and FrdB subunits at the optimal orientation relative to the membrane surface, ensuring efficient electron transfer from menaquinol to fumarate.

Researchers have developed a structural stability assay that measures the resistance of the complex to thermal and chemical denaturation. This approach has demonstrated that mutations in FrdD significantly reduce the half-life of the assembled complex, highlighting its importance in maintaining structural integrity over time.

How does the regulation of frdD expression correlate with changes in environmental conditions?

The expression of frdD, as part of the frdABCD operon, demonstrates sophisticated regulatory mechanisms that respond to environmental conditions. Research has established a clear correlation between oxygen availability, alternative electron acceptors, and frdD expression:

Table 2: Environmental Factors Affecting frdD Expression

Environmental FactorEffect on frdD ExpressionRegulatory MechanismDetection Method
Oxygen levelRepressed under aerobic conditionsFNR-mediated activation under anaerobic conditionsqRT-PCR, frdD-lacZ fusion
Fumarate availabilityInduced in presence of fumarateDcuS-DcuR two-component systemNorthern blot analysis
Nitrate presenceRepressed when nitrate is availableNarL-mediated repressionTranscriptome analysis
Carbon sourceEnhanced with glycerol versus glucoseCRP-cAMP dependent activationProteomics analysis

The regulation of frdD expression is particularly interesting because it represents a strategic metabolic adaptation. When oxygen becomes limited, E. coli shifts from aerobic respiration to anaerobic respiration using alternative electron acceptors like fumarate. The frdABCD operon, including frdD, is induced specifically when fumarate is available as a terminal electron acceptor, allowing the bacterium to continue energy production under anaerobic conditions .

This regulatory network ensures that the energetically expensive synthesis of fumarate reductase components, including FrdD, occurs only when their function will benefit cellular metabolism. The tight correlation between environmental conditions and frdD expression highlights the importance of this protein in adaptive metabolism.

How does the function of FrdD in recombinant E. coli O17:K52:H18 compare with its role in other E. coli strains?

Comparative analysis of FrdD function across different E. coli strains reveals both conservation of core functionality and strain-specific adaptations. While the fundamental role of FrdD in anchoring the fumarate reductase complex to the membrane and facilitating quinone interaction remains consistent, several notable differences have been documented:

  • Sequence Variations: Amino acid sequence analysis of FrdD from different E. coli strains, including pathogenic variants like O157:H7, reveals specific substitutions that may influence protein-protein interactions within the complex .

  • Expression Levels: Quantitative proteomics has demonstrated that recombinant E. coli O17:K52:H18 typically expresses higher levels of FrdD under anaerobic conditions compared to laboratory strains like K-12, potentially enhancing its anaerobic respiratory capacity.

  • Quinone Specificity: The FrdD subunit in some strains shows altered affinity for different quinone species, reflecting adaptations to specific environmental niches where particular electron carriers might be more available.

  • Regulatory Differences: The regulation of the frdABCD operon shows strain-specific variations, with some strains demonstrating more responsive regulation to changing environmental conditions.

These differences suggest that while the core structural and functional aspects of FrdD are conserved across E. coli strains, evolutionary adaptations have fine-tuned its properties to optimize performance in specific ecological contexts. For researchers working with recombinant systems, these strain-specific differences must be considered when interpreting experimental results or designing expression systems.

What are the optimal conditions for expressing recombinant FrdD in heterologous systems?

Successful expression of functional recombinant FrdD requires careful optimization of multiple parameters due to its hydrophobic nature and involvement in multi-subunit complex formation. Based on extensive research, the following conditions have been established as optimal:

Table 3: Optimized Expression Conditions for Recombinant FrdD

ParameterOptimal ConditionRationaleImpact on Yield
Expression vectorpET-28a with T7 promoterTight regulation, high expression3-fold increase
Host strainC43(DE3)Tolerates membrane protein expression5-fold increase
Induction0.1 mM IPTG at OD₆₀₀ = 0.6Prevents toxicity from overexpression2-fold increase
Growth temperature30°C pre-induction, 18°C post-inductionImproves proper folding4-fold increase
Media compositionLB with 1% glucose pre-inductionPrevents leaky expressionMinimal effect
Co-expressionWith FrdCStabilizes FrdD7-fold increase
Oxygen conditionsSwitch to anaerobic post-inductionMimics native expression conditions3-fold increase

For researchers attempting to express FrdD alone (without other Frd subunits), it is critical to note that co-expression with FrdC significantly improves stability and yield. When expressing the complete fumarate reductase complex, a polycistronic construct containing the entire frdABCD operon under a single promoter typically yields the best results in terms of complex assembly and functionality .

Additionally, the inclusion of membrane-mimicking environments such as appropriate detergents (n-dodecyl-β-D-maltoside at 0.1%) in the lysis buffer is essential for maintaining the structural integrity of FrdD during extraction and purification.

What genetic manipulation techniques are most effective for creating recombinant E. coli strains with modified FrdD?

Creating recombinant E. coli strains with modified FrdD requires specialized genetic manipulation techniques that account for the challenges associated with membrane protein modification. Based on successful research approaches, the following methodologies have proven most effective:

  • λ Red Recombineering: This technique enables precise chromosomal integration or modification of the frdD gene without the need for traditional restriction sites. For optimal results:

    • Target the frdD gene with PCR products containing 40-50 bp homology arms

    • Perform recombineering in strains expressing the λ Red recombination system

    • Select recombinants using a removable antibiotic resistance cassette

    • Verify modifications by sequencing and functional assays

  • CRISPR-Cas9 Genome Editing: For introducing specific point mutations or small insertions/deletions:

    • Design sgRNAs targeting specific regions within frdD

    • Provide repair templates with desired modifications

    • Confirm edits through phenotypic screening on restrictive media

    • Verify by sequencing and enzyme activity assays

  • Plasmid-Based Complementation: For testing variant forms of FrdD:

    • Clone modified frdD sequences into low-copy plasmids

    • Transform into ΔfrdD strains

    • Assess functional complementation through growth under anaerobic conditions with fumarate

    • Measure fumarate reductase activity using standardized biochemical assays

Researchers should note that modifications to FrdD often affect the assembly and stability of the entire fumarate reductase complex. Therefore, monitoring the expression and membrane integration of all four subunits is crucial when evaluating the effects of FrdD modifications. Additionally, changes to FrdD may impact interaction with quinones, which can be assessed through electron transfer assays using menaquinol and various quinone analogs .

How can recombination methodologies be applied to study FrdD variants across diverse E. coli strains?

Investigating FrdD variants across diverse E. coli strains requires sophisticated recombination methodologies that can facilitate comparative functional analysis. Researchers have developed several effective approaches:

  • Conjugation-Based Transfer: Horizontal gene transfer techniques can be employed to exchange frdD alleles between strains. For optimal results:

    • Construct F' plasmids carrying different frdD variants

    • Perform controlled matings between donor and recipient strains

    • Select for transconjugants on media that requires functional fumarate reductase

    • Verify gene transfer through phenotypic and genotypic analysis

  • RecA-Independent Recombination: For strains where traditional RecA-dependent recombination is inefficient:

    • Utilize alternative recombination systems that function independently of RecA

    • Optimize mating durations (18 hours yields sufficient recombinants in RecA-deficient backgrounds)

    • Consider rhamnose induction systems for controlled expression of recombination functions

    • Validate recombination events through appropriate antibiotic selection markers

  • Comparative Genomic Integration: For systematic analysis of frdD variants:

    • Create a library of frdD alleles from diverse E. coli strains

    • Integrate each variant at a neutral site in a common genetic background

    • Assess functional differences through standardized fumarate reductase activity assays

    • Correlate sequence variations with functional differences

Table 4: Recombination Efficiency with Different FrdD Variants

Donor StrainRecipient StrainRecombination MethodMating DurationRecombination Efficiency (%)Key Findings
E. coli K-12 with wild-type frdDΔfrdD strainF' plasmid conjugation0.25 h0.87High transfer efficiency
E. coli O157:H7 with variant frdDΔfrdD strainF' plasmid conjugation0.25 h0.92Comparable to K-12
RecA-deficient strain with frdD variantRecA-deficient recipientRecA-independent transfer18 h0.003Significantly lower but detectable
Rhamnose-induced systemStandard recipientControlled expression0.25 h1.23Enhanced with induction

These methodologies have revealed that despite sequence variations in FrdD across different E. coli strains, the core functional domains remain highly conserved, suggesting strong evolutionary pressure to maintain the protein's role in anaerobic respiration .

What spectroscopic methods provide the most insight into FrdD's role in electron transfer?

Advanced spectroscopic techniques have revolutionized our understanding of FrdD's involvement in electron transfer processes within the fumarate reductase complex. The following methodologies offer complementary insights:

  • Electron Paramagnetic Resonance (EPR) Spectroscopy: This technique provides direct observation of electron transfer events involving FrdD and quinones:

    • Continuous wave EPR can detect semiquinone intermediates formed during electron transfer

    • Pulsed EPR methods reveal the distance between redox centers

    • Site-directed spin labeling of FrdD combined with EPR maps conformational changes during catalysis

  • Resonance Raman Spectroscopy: Particularly valuable for studying quinone binding sites in FrdD:

    • Provides vibrational fingerprints of bound quinones

    • Distinguishes between different quinone binding environments

    • Detects subtle changes in quinone structure during redox cycling

  • Fluorescence Resonance Energy Transfer (FRET):

    • When combined with strategic labeling of FrdD and other subunits, FRET reveals dynamic interactions during electron transfer

    • Real-time monitoring of conformational changes can be achieved

    • The technique has demonstrated that FrdD undergoes significant movement during the catalytic cycle

These spectroscopic approaches have collectively demonstrated that FrdD is not merely a passive anchor for the catalytic domain but actively participates in electron transfer through:

  • Creating optimal electronic environments for quinone binding

  • Facilitating conformational changes that promote efficient electron tunneling

  • Contributing to the differential reactivity with menaquinol versus ubiquinone

Researchers applying these techniques have observed that mutations in specific transmembrane helices of FrdD alter the EPR signals associated with bound semiquinones, providing direct evidence for FrdD's involvement in creating the electronic environment necessary for electron transfer .

What computational approaches are most effective for predicting FrdD interactions with quinones?

Computational modeling has become an indispensable tool for understanding the complex interactions between FrdD and various quinone species. Several approaches have demonstrated particular utility:

  • Molecular Dynamics (MD) Simulations:

    • All-atom MD simulations in explicit membrane environments reveal quinone binding dynamics

    • Typically require 100-500 ns simulation time for adequate sampling

    • Have identified specific residues in FrdD that form hydrogen bonds with quinone head groups

    • Predict conformational changes in FrdD transmembrane helices upon quinone binding

  • Quantum Mechanics/Molecular Mechanics (QM/MM) Calculations:

    • Essential for modeling electron transfer reactions involving FrdD and quinones

    • The quinone and key FrdD residues are treated quantum mechanically

    • The remainder of the protein and membrane environment is treated with molecular mechanics

    • These calculations have revealed the step-wise nature of electron transfer and energy barriers

  • Machine Learning Approaches:

    • Deep learning models trained on experimental binding data can predict:

      • Binding affinities between FrdD variants and different quinones

      • Optimal quinone structures for specific FrdD variants

      • Functional consequences of FrdD mutations

Table 5: Comparative Performance of Computational Methods for FrdD-Quinone Interactions

Computational MethodAccuracy for Binding Site PredictionComputational CostKey Insights Provided
Molecular DockingModerate (65-75%)LowInitial binding poses
MD SimulationsHigh (80-90%)Moderate to HighBinding dynamics, conformational changes
QM/MM CalculationsVery High (>90%) for electronic detailsVery HighElectron transfer mechanisms
Machine LearningVariable (70-85%) depending on training dataLow (after training)Rapid screening of variants

These computational approaches have collectively provided evidence for a two-site model of quinone interaction with the fumarate reductase complex, consistent with experimental findings showing separation of oxidative and reductive activities with quinones. The simulations suggest that FrdD contributes primarily to the menaquinol oxidation site, with specific residues creating an environment that favors electron extraction from menaquinol .

How can understanding FrdD function contribute to developing new antimicrobial strategies?

The critical role of FrdD in anaerobic respiration makes it a promising target for novel antimicrobial development, particularly for treating infections in oxygen-limited environments such as abscesses or the intestinal tract. Several research directions have demonstrated potential:

  • FrdD-Specific Inhibitors:

    • Compounds that bind specifically to FrdD can disrupt quinone interactions

    • This selectively inhibits anaerobic respiration without affecting aerobic metabolism

    • Structure-based drug design has identified several lead compounds that bind the quinone interaction site on FrdD

  • Exploiting Structural Differences:

    • Subtle structural differences exist between FrdD in commensal and pathogenic E. coli strains, including O157:H7

    • These differences can be targeted to develop strain-specific inhibitors

    • Computational approaches have identified unique binding pockets in pathogenic strain FrdD variants

  • Combination Therapies:

    • FrdD inhibitors show synergistic effects when combined with conventional antibiotics

    • This approach is particularly effective against biofilms, where bacteria often rely on anaerobic metabolism

    • The combination prevents adaptive resistance development

Researchers have demonstrated that blocking FrdD function significantly reduces the virulence of pathogenic E. coli strains in animal infection models, particularly under oxygen-limited conditions. This approach offers a potential alternative to conventional antibiotics, addressing the growing concern of antimicrobial resistance in E. coli infections .

What are the most promising future research directions for FrdD in recombinant systems?

Several high-potential research directions for FrdD in recombinant systems have emerged from recent advances:

  • Structural Biology Approaches:

    • Cryo-electron microscopy has begun to reveal the detailed structure of the fumarate reductase complex

    • Future work should focus on capturing different conformational states during the catalytic cycle

    • Particular emphasis should be placed on visualizing FrdD's interaction with quinones at atomic resolution

  • Synthetic Biology Applications:

    • Engineered FrdD variants could enhance electron transfer efficiency in biofuel cells

    • Recombinant systems with optimized FrdD could improve industrial production of succinic acid

    • Designing chimeric FrdD proteins that can interact with non-native electron carriers could expand the metabolic capabilities of E. coli

  • Systems Biology Integration:

    • Multi-omics approaches combining proteomics, metabolomics, and fluxomics will provide a comprehensive understanding of how FrdD functions within the broader metabolic network

    • Mathematical modeling of electron transfer chains incorporating FrdD will enable prediction of metabolic responses to environmental changes

  • Evolutionary Studies:

    • Comparative analysis of FrdD across diverse bacterial species may reveal adaptation strategies for different ecological niches

    • Directed evolution approaches could generate FrdD variants with enhanced function under specific conditions

These research directions promise to not only advance our fundamental understanding of membrane-bound electron transfer systems but also to develop practical applications in biotechnology, medicine, and synthetic biology. The integration of structural insights with functional studies will be particularly important for realizing the full potential of FrdD in recombinant systems .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.