Recombinant Escherichia coli O17:K52:H18 p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery timelines.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
aaeA; ECUMN_3715; p-hydroxybenzoic acid efflux pump subunit AaeA; pHBA efflux pump protein A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Target Names
aaeA
Target Protein Sequence
MKTLIRKFSRTAITVVLVILAFIAIFNAWVYYTESPWTRDARFSADVVAIAPDVSGLITQ VNVHDNQLVKKGQVLFTIDQPRYQKALEEAQADVAYYQVLAQEKRQEAGRRNRLGVQAMS REEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPADGWVTNLNVYTGEFITRGS TAVALVKQNSFYVLAYMEETKLEGVRPGYRAEITPLGSNKVLKGTVDSVAAGVTNASSTS DDKGMATIDSNLEWVRLAQRVPVRIRLDNQQENIWPAGTTATVVVTGKQDRDESQDSFFR KMAHRLREFG
Uniprot No.

Target Background

Function
Forms an efflux pump in conjunction with AaeB.
Database Links
Protein Families
Membrane fusion protein (MFP) (TC 8.A.1) family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the AaeA efflux pump subunit and what is its role in E. coli?

AaeA (formerly known as YhcQ) is a membrane fusion protein that functions as a critical component of the AaeAB efflux system in Escherichia coli. This protein works in conjunction with AaeB (formerly YhcP) to form a functional efflux pump that removes aromatic carboxylic acids from the bacterial cell. The AaeA subunit is specifically responsible for creating a channel that bridges the inner and outer membranes, facilitating the export of substrates from the cytoplasm to the extracellular environment .

The AaeAB efflux system is particularly important for E. coli's response to p-hydroxybenzoic acid (pHBA) and other aromatic carboxylic acids. Research has demonstrated that the system likely serves as a "metabolic relief valve" that helps the bacterium alleviate potential toxic effects that might arise from imbalanced metabolism . This function is critical for bacterial survival under conditions where harmful metabolic intermediates might accumulate.

How is the AaeA efflux pump subunit regulated in E. coli?

The expression of the aaeA gene (formerly yhcQ) is predominantly regulated by AaeR (formerly YhcS), a transcriptional regulator belonging to the LysR family of positive-acting regulatory molecules. AaeR is encoded by a gene located immediately adjacent to and divergently transcribed from the aaeXAB operon (formerly yhcRQP) .

Experimental evidence has confirmed this regulatory relationship through studies using aaeR null mutations and plasmids carrying aaeXAB-luxCDABE gene fusions. When E. coli is exposed to p-hydroxybenzoic acid (pHBA), the aaeR gene product activates transcription of the aaeXAB operon. In wild-type strains carrying the aaeXAB-luxCDABE fusion, exposure to 25 mM pHBA resulted in a dramatic 300-fold increase in bioluminescence, indicating substantial upregulation of the operon. This upregulation was completely abolished in aaeR mutant strains, confirming AaeR's role as the primary regulator .

Several aromatic weak acid molecules have been identified as activators of AaeR, including pHBA, sodium salicylate (77-fold increase), sodium benzoate (12-fold increase), and 1-naphthoate (130-fold increase) .

What is the relationship between E. coli O17:K52:H18 and other pathogenic E. coli strains?

E. coli O17:K52:H18 belongs to the O11/O17/O77:K52:H18 clonal group, also known as clonal group A (CGA), which is a significant lineage within the extraintestinal pathogenic E. coli (ExPEC) pathotype. This clonal group has been identified in patients with serious invasive infections beyond the urinary tract, demonstrating the pathogenic versatility of these strains .

Molecular characterization studies have revealed that E. coli O17:K52:H18, like other strains in the O11/O17/O77:K52:H18 clonal group, exhibits virulence genotypes and genomic profiles similar to those of established ExPEC clones. This includes similarity to strains traditionally associated with urinary tract infections and meningitis, such as E. coli O1/O2:K1:H7 and E. coli O18:K1:H7 .

Notably, the O11/O17/O77:K52:H18 clonal group has been found to be multidrug-resistant and capable of causing a broader range of extraintestinal infections than previously recognized. These infections are not limited to uncomplicated urinary tract infections and can affect diverse patient populations beyond young women .

What are the recommended methods for genetically engineering recombinant E. coli to express or modify the AaeA efflux pump?

The genetic modification of E. coli to express or alter the AaeA efflux pump requires a systematic approach combining molecular cloning, transformation, and phenotypic validation techniques. Based on established protocols in the literature, the following methodology is recommended:

Plasmid Construction and Transformation:

  • Design PCR primers to amplify the aaeA gene with appropriate restriction sites for cloning

  • Clone the amplified aaeA sequence into a suitable expression vector (e.g., pETDuet1)

  • Transform the recombinant plasmid into an appropriate E. coli strain (DH5α or BL21(DE3) are commonly used)

  • Confirm successful transformation by colony PCR and sequencing

Expression Validation:

  • Induce expression using an appropriate inducer (IPTG for T7 promoter-based systems)

  • Verify gene expression by qRT-PCR to quantify transcript levels

  • Confirm protein production through Western blotting using anti-AaeA antibodies

Functional Characterization:

  • Assess efflux pump function through susceptibility testing with known substrates (e.g., pHBA)

  • Compare growth rates of recombinant strains versus control strains in the presence of toxins

  • Measure direct efflux activity using fluorescent dyes that are substrates for the pump

For advanced studies involving the specific E. coli O17:K52:H18 strain, researchers should obtain the reference strain and perform P1clr100Cm-mediated transduction to create derivatives with specific gene modifications, as demonstrated in previous studies with other E. coli strains .

How can researchers effectively measure AaeA efflux pump activity in recombinant E. coli strains?

Accurate measurement of AaeA efflux pump activity is critical for characterizing both wild-type and recombinant systems. Several complementary approaches can be employed:

Susceptibility Testing:

  • Determine the minimum inhibitory concentration (MIC) of known pump substrates (pHBA, salicylate, benzoate, and 1-naphthoate)

  • Compare MICs between wild-type, pump-deficient mutants, and recombinant strains

  • A functional efflux system will demonstrate higher MICs compared to deficient strains

Reporter Gene Assays:

  • Construct strains carrying aaeA promoter fusions to reporter genes (e.g., luxCDABE)

  • Measure bioluminescence in response to inducing compounds

  • Quantify the fold-increase in reporter activity (documented ranges: 12-fold for benzoate to 300-fold for pHBA at 25 mM)

Direct Efflux Measurement:

  • Load cells with fluorescent efflux pump substrates (e.g., ethidium bromide, Nile red)

  • Monitor fluorescence decay after adding glucose to energize cells

  • Calculate efflux rates based on fluorescence intensity changes over time

pH-Dependent Accumulation Assays:

  • Expose cells to radioactively labeled substrates at different pH values

  • Measure intracellular accumulation of substrates

  • Plot accumulation vs. pH to determine the optimal conditions for efflux activity

The combination of these methods provides a comprehensive assessment of AaeA-mediated efflux activity, allowing researchers to quantitatively compare different strains and conditions.

What culture conditions optimize the expression of AaeA in recombinant E. coli systems?

Optimizing culture conditions for AaeA expression requires careful consideration of multiple factors that affect both gene expression and protein functionality:

Growth Medium Composition:

  • Minimal media (e.g., Vogel-Bonner) allows better control of aromatic acid inducers

  • Rich media (e.g., LB) provides faster growth but may contain compounds that affect expression

  • Supplementation with specific carbon sources can alter metabolic flux through pathways producing aromatic acids

Induction Parameters:

  • Concentration of inducer: For pHBA, 25 mM has shown significant induction (300-fold)

  • Growth phase: Mid-logarithmic phase (OD600 = 0.2-0.5) is optimal for induction

  • Duration of induction: 30-60 minutes is typically sufficient for robust expression

Environmental Conditions:

  • Temperature: 30°C is optimal for balancing growth rate and protein folding

  • pH: Maintain at 7.0-7.5 to ensure proper ionization state of inducers

  • Aeration: Vigorous aeration (200-250 rpm) ensures adequate oxygen for metabolism

Table 1: Optimization Parameters for AaeA Expression in E. coli

ParameterOptimal RangeNotes
Growth MediumVogel-Bonner minimalMinimizes background induction
Cell Density at InductionOD600 = 0.2-0.5Mid-logarithmic phase
Inducer ConcentrationpHBA: 10-25 mM25 mM yields 300-fold induction
Salicylate: 5-10 mM6.2 mM yields 77-fold induction
Benzoate: 10-15 mM12.5 mM yields 12-fold induction
Induction Time30-60 minutesFor transcriptional response
Temperature30°CBalances growth and expression
pH7.0-7.5Optimal for inducer activity
Aeration200-250 rpmEnsures adequate oxygenation

These conditions should be further optimized for specific recombinant constructs and host strains, as protein expression can vary significantly based on the specific genetic context.

How does the structure-function relationship of AaeA compare to other membrane fusion proteins in different efflux systems?

The AaeA protein belongs to the membrane fusion protein (MFP) family, which plays a crucial role in bridging the inner and outer membranes in tripartite efflux systems. Comparing AaeA to other MFPs reveals important structural and functional insights:

Structural Domains and Organization:

  • MFPs typically consist of three core domains: a membrane-proximal domain, a β-barrel domain, and a lipoyl domain

  • AaeA shares this general architecture but exhibits specific adaptations for aromatic carboxylic acid transport

  • Unlike AcrA (another E. coli MFP), AaeA does not appear to require TolC as an outer membrane channel

Functional Partnerships:

  • AaeA functions primarily with AaeB, forming a specialized system for aromatic carboxylic acid efflux

  • This is distinct from the AcrA-AcrB-TolC system, which has a broader substrate range including antibiotics

  • The AaeAB system shows higher specificity, with only a few aromatic carboxylic acids identified as substrates

Regulatory Mechanisms:

  • AaeA expression is tightly controlled by AaeR, a LysR-type regulator responding to specific inducer molecules

  • This contrasts with the AcrAB system, which is regulated by global stress response regulators (MarA, SoxS, Rob)

  • The tight regulation of AaeA suggests its specialized role in managing metabolic intermediates rather than general xenobiotic defense

Evolutionary Conservation:

  • Phylogenetic analysis places AaeA in a distinct clade from other well-characterized MFPs

  • The AaeAB system appears to be conserved across E. coli strains, including pathogenic variants

  • The specialization for aromatic carboxylic acids suggests a fundamental role in managing specific metabolic pathways

This comparison highlights AaeA as a specialized MFP that has evolved to manage specific metabolic challenges rather than providing broad-spectrum resistance to diverse compounds.

What is the role of the AaeA efflux pump in antibiotic resistance, and how might it be targeted for efflux pump inhibitors?

The AaeA efflux pump component, while not primarily associated with antibiotic resistance, may still contribute to reduced susceptibility to certain antimicrobial compounds. Understanding this relationship has important implications for addressing antimicrobial resistance:

Contribution to Antimicrobial Resistance:

  • Direct efflux: The AaeAB system has specificity for aromatic carboxylic acids, but may have activity against structurally similar antibiotics

  • Cross-protection: Upregulation of AaeAB may indirectly protect cells by maintaining metabolic homeostasis under antibiotic stress

  • Synergistic effects: AaeAB may work in concert with other efflux systems (like AcrAB-TolC) in multidrug-resistant strains

Potential for Targeted Inhibition:

  • Structural targeting: Inhibitors designed to disrupt AaeA's interaction with AaeB could compromise pump function

  • Regulatory intervention: Compounds that interfere with AaeR activation would prevent pump expression

  • Substrate competition: Non-toxic structural analogs of aromatic carboxylic acids may competitively inhibit efflux

Development Considerations for Efflux Pump Inhibitors (EPIs):

  • Specificity: EPIs specifically targeting AaeA would have less broad effects than inhibitors of RND pumps like AcrB

  • Synergy testing: Potential EPIs should be evaluated in combination with antibiotics to assess potentiation effects

  • Resistance development: The likelihood of resistance to AaeA-specific inhibitors may be lower due to its specialized role

Table 2: Potential Strategies for AaeA Inhibition

Inhibition StrategyTargetMechanismPotential Advantages
Competitive InhibitionSubstrate binding siteOccupation by structural analogsSpecificity for AaeAB system
Allosteric InhibitionNon-substrate sitesConformational disruptionMay affect multiple pump cycles
Disruptor of AaeA-AaeB InterfaceProtein-protein interactionPrevention of complex formationHighly specific approach
AaeR AntagonistsRegulatory proteinPrevention of transcriptional activationBlocks expression of entire system
Energy DepletionProton motive forceUncoupling energy from transportAffects multiple efflux systems

While the primary role of AaeAB appears to be managing metabolic intermediates rather than antibiotic resistance, the increasing prevalence of multidrug-resistant E. coli strains makes all efflux systems potential targets for therapeutic intervention.

How does the AaeA efflux pump in E. coli O17:K52:H18 contribute to virulence and pathogenesis in extraintestinal infections?

E. coli O17:K52:H18, as part of the O11/O17/O77:K52:H18 clonal group A, has been associated with diverse extraintestinal infections. The AaeA efflux pump may contribute to the pathogenesis of these infections through several mechanisms:

Metabolic Adaptation in Host Environments:

  • Host aromatic compounds: The AaeAB efflux system may protect bacteria from host-derived aromatic antimicrobials

  • Metabolic flexibility: Efficient removal of toxic metabolic intermediates allows adaptation to nutrient-limited host environments

  • pH adaptation: The pump's activity across different pH conditions supports survival in diverse host niches

Contribution to Tissue-Specific Pathogenesis:

  • Respiratory infections: AaeAB may contribute to lung colonization by managing aromatic compounds in respiratory mucosa

  • Wound infections: The pump may protect against antimicrobial compounds in wound exudates

  • Bone and joint infections: AaeAB could support adaptation to the unique metabolic environment of bone tissue

Interaction with Host Immune Responses:

Evidence from Clinical Isolates:

  • E. coli O17:K52:H18 has been isolated from serious, invasive non-urinary infections including pneumonia, surgical wound infections, and vertebral osteomyelitis

  • These isolates demonstrate characteristic virulence genotypes similar to other ExPEC strains

  • The multidrug resistance observed in these isolates may involve cooperation between AaeAB and other efflux systems

The pathogenic versatility of E. coli O17:K52:H18 suggests that systems like AaeAB, while not classical virulence factors, may contribute significantly to the strain's ability to adapt to diverse host environments and establish extraintestinal infections.

What approaches can resolve difficulties in expressing functional AaeA protein in heterologous systems?

Researchers often encounter challenges when attempting to express membrane proteins like AaeA in heterologous systems. Several strategies can address these difficulties:

Optimization of Expression Constructs:

  • Codon optimization: Adjust codon usage to match the preferred codons of the expression host

  • Signal sequence modification: Ensure proper targeting to the membrane by optimizing signal sequences

  • Fusion tags: Add solubility-enhancing tags (e.g., MBP, SUMO) that can be cleaved post-purification

  • Promoter selection: Use tunable promoters that allow control over expression levels to prevent toxicity

Host Strain Selection:

  • Use specialized E. coli strains designed for membrane protein expression (e.g., C41(DE3), C43(DE3))

  • Consider strains with reduced protease activity to minimize degradation

  • Evaluate strains with altered membrane composition that may better accommodate the target protein

Expression Conditions:

  • Lower temperature (16-25°C) to slow protein synthesis and facilitate proper folding

  • Reduce inducer concentration to prevent toxic accumulation of misfolded protein

  • Add specific membrane-stabilizing compounds (e.g., glycerol, specific lipids) to the growth medium

  • Include chemical chaperones to assist in proper protein folding

Co-expression Strategies:

  • Co-express AaeA with its natural partner AaeB to promote proper complex formation

  • Include molecular chaperones (GroEL/GroES, DnaK/DnaJ) to assist folding

  • Consider co-expression with the AaeR regulator under controlled conditions

Table 3: Troubleshooting Guide for AaeA Expression

ChallengePotential CausesSolutions
Low expression levelsPoor transcription/translationOptimize promoter, ribosome binding site, codon usage
Protein toxicityUse tightly regulated inducible system, lower temperature
Inclusion body formationRapid overexpressionReduce inducer concentration, lower temperature (16-20°C)
Improper foldingCo-express with chaperones, add chemical chaperones
Membrane instabilityProtein overload in membraneRegulate expression level, use specialized host strains
Improper insertionOptimize signal sequences, consider fusion constructs
Protein degradationProtease activityUse protease-deficient strains, add protease inhibitors
Instability of isolated proteinCo-express with partner proteins, optimize buffer conditions
Lack of functionImproper foldingVerify membrane localization, optimize expression conditions
Missing partnersCo-express with AaeB, consider complete operon expression

By systematically addressing these challenges, researchers can significantly improve the likelihood of successfully expressing functional AaeA protein in heterologous systems for further characterization and application.

How can researchers accurately differentiate between the activity of AaeA and other efflux pumps in experimental systems?

Distinguishing the specific contribution of AaeA from other efflux pumps presents a significant challenge in E. coli, which possesses multiple efflux systems. Several methodological approaches can help researchers isolate AaeA-specific activity:

Genetic Approach:

  • Generate single and combinatorial knockout strains (ΔaaeA, ΔacrA, ΔaaeA/ΔacrA, etc.)

  • Complement with plasmid-expressed wild-type or mutant AaeA

  • Compare substrate specificity profiles across these strains

  • Use transposon mutant libraries to identify and characterize specific efflux components

Biochemical Approach:

  • Develop AaeA-specific antibodies for immunoprecipitation and Western blotting

  • Use substrate competition assays with known AaeA-specific compounds

  • Perform membrane vesicle transport assays with purified components

  • Apply specific inhibitors with known selectivity for different pump families

Transcriptional Analysis:

  • Use reporter constructs with aaeA promoter fusions to monitor specific transcriptional responses

  • Compare transcriptional profiles after exposure to known inducers (e.g., pHBA, salicylate)

  • Employ qRT-PCR to quantify expression levels of different efflux pump genes

  • Perform RNA-seq to capture the complete transcriptional response

Substrate Specificity Profiling:

  • Test a panel of diverse compounds as potential substrates

  • Focus on aromatic carboxylic acids (AaeAB substrates) versus other compound classes

  • Measure MICs across different pH values to leverage differential ionization properties

  • Compare results to known substrate profiles of other efflux systems

Table 4: Distinguishing Features of Major E. coli Efflux Systems

Efflux SystemMain ComponentsPrimary SubstratesInducersOuter Membrane Component
AaeABAaeA, AaeBAromatic carboxylic acidspHBA, salicylate, benzoateNot required (TolC-independent)
AcrAB-TolCAcrA, AcrB, TolCDiverse antibiotics, dyes, detergentsGeneral stress, MarA/SoxS/RobTolC required
EmrAB-TolCEmrA, EmrB, TolCHydrophobic compounds, uncouplersCarbonyl cyanide m-chlorophenylhydrazoneTolC required
MdtABC-TolCMdtA, MdtB, MdtC, TolCBile salts, novobiocinBile saltsTolC required

By leveraging these distinguishing characteristics and methodological approaches, researchers can more accurately attribute observed phenotypes to AaeA-specific activity versus contributions from other efflux systems.

What are the most effective approaches for analyzing the interaction between AaeA and AaeB in the functional efflux complex?

Understanding the molecular interactions between AaeA and AaeB is crucial for elucidating the mechanism of this specialized efflux system. Several complementary techniques can provide insights into these protein-protein interactions:

Structural Biology Approaches:

  • X-ray crystallography of the AaeA-AaeB complex (challenging due to membrane protein nature)

  • Cryo-electron microscopy to visualize the assembled complex in a near-native state

  • NMR spectroscopy for dynamic interaction studies of specific domains

  • Molecular modeling based on homologous proteins with known structures

Biochemical Interaction Analyses:

  • Co-immunoprecipitation to confirm physical association in vivo

  • Bacterial two-hybrid assays to map interacting domains

  • Chemical cross-linking coupled with mass spectrometry to identify interaction interfaces

  • Surface plasmon resonance to measure binding kinetics and affinity

Functional Characterization:

  • Site-directed mutagenesis of predicted interaction residues

  • Complementation assays with mutant variants in knockout strains

  • Suppressor mutation analysis to identify compensatory changes

  • In vitro reconstitution of purified components in liposomes to assess transport activity

Biophysical Techniques:

  • Förster resonance energy transfer (FRET) between fluorescently labeled AaeA and AaeB

  • Microscale thermophoresis to measure binding affinity under near-native conditions

  • Hydrogen-deuterium exchange mass spectrometry to identify protected interfaces

  • Atomic force microscopy to visualize complex formation in membrane preparations

Table 5: Key Domains for AaeA-AaeB Interaction Analysis

ProteinDomainPredicted FunctionMutation Strategy for Interaction Studies
AaeAN-terminal domainMembrane anchoringTruncation, conservative substitutions
α-helical hairpinTolC docking (if applicable)Helix-breaking mutations (Pro substitutions)
β-barrel domainCentral channel formationCharge reversal at predicted interfaces
Membrane-proximal domainAaeB interactionAlanine scanning of conserved residues
AaeBTransmembrane domainsChannel formationConservative substitutions in predicted interface
Periplasmic loopsAaeA dockingTruncation, charge alterations
Substrate binding pocketAromatic acid bindingConservative substitutions of binding residues
Proton relay networkEnergy couplingSubstitution of key acidic/basic residues

By combining these approaches, researchers can develop a comprehensive understanding of how AaeA and AaeB interact to form a functional efflux system, which could inform future efforts to modulate or mimic this system for biotechnological or therapeutic applications.

What emerging technologies might advance our understanding of AaeA structure and function in E. coli O17:K52:H18?

Several cutting-edge technologies have the potential to significantly enhance our understanding of AaeA structure and function in the context of E. coli O17:K52:H18:

Advanced Structural Biology Techniques:

  • Single-particle cryo-electron microscopy with improved resolution for membrane proteins

  • Microcrystal electron diffraction (MicroED) for structure determination from smaller crystals

  • Integrative structural biology combining multiple data sources (X-ray, EM, crosslinking, simulation)

  • Time-resolved structural methods to capture different conformational states during transport

Genome Engineering Approaches:

  • CRISPR-Cas9 precise genome editing to create targeted mutations in native genetic contexts

  • Multiplexed genome engineering to systematically map genetic interactions

  • CRISPRi/CRISPRa for tunable gene expression without permanent genetic modifications

  • In situ epitope tagging for visualization and purification of native complexes

Single-Cell and Single-Molecule Techniques:

  • Single-molecule fluorescence microscopy to track AaeA localization and dynamics

  • Patch-clamp electrophysiology adapted for efflux pump activity measurements

  • Microfluidic single-cell analysis to correlate pump activity with cellular phenotypes

  • Super-resolution microscopy to visualize nanoscale organization of efflux complexes

Computational and Systems Biology Approaches:

  • Molecular dynamics simulations of AaeA-AaeB interactions in realistic membrane environments

  • Deep learning prediction of protein-protein interactions and functional sites

  • Systems-level metabolic modeling to predict the role of AaeAB in managing metabolic flux

  • Evolutionary analysis across diverse E. coli strains to identify adaptive signatures

Multi-omics Integration:

  • Combined transcriptomics, proteomics, and metabolomics under AaeAB activation conditions

  • Spatial transcriptomics and proteomics during host-pathogen interactions

  • Interactome mapping to identify all protein partners of AaeA in different conditions

  • Integrative analysis correlating genotype, pump expression, and antimicrobial resistance

These emerging technologies, particularly when used in combination, offer unprecedented opportunities to understand the structural basis of AaeA function, its regulation in different conditions, and its contribution to the pathogenic potential of E. coli O17:K52:H18.

How might the AaeA efflux pump system be exploited for biotechnological applications?

The specialized nature of the AaeA-AaeB efflux system presents several opportunities for biotechnological applications that leverage its ability to export aromatic carboxylic acids:

Bioproduction of High-Value Compounds:

  • Engineering E. coli to overproduce and export valuable aromatic acids (e.g., vanillic acid, ferulic acid)

  • Reducing product toxicity through continuous export, potentially increasing yield

  • Creating feedback-resistant production strains where product accumulation upregulates its own export

  • Developing two-phase fermentation systems where exported products partition into organic phases

Biosensing Applications:

  • Engineering AaeA-based whole-cell biosensors for environmental monitoring of aromatic pollutants

  • Developing reporter systems using the aaeA promoter fused to easily detectable outputs

  • Creating tunable biosensors with modified AaeR regulators having altered substrate specificity

  • Integrating AaeA-based sensing with microfluidic or electronic detection systems

Bioremediation Strategies:

  • Engineering enhanced AaeA-AaeB systems for improved export of environmental contaminants

  • Developing bacterial strains with modified substrate specificity for specific pollutants

  • Creating consortia of engineered bacteria with complementary efflux capabilities

  • Designing immobilized cell systems for continuous bioremediation processes

Protein Engineering Platforms:

  • Using AaeA as a scaffold for designing novel transport proteins with altered specificity

  • Developing AaeA-based membrane protein production and purification systems

  • Engineering AaeA fusion proteins for targeted delivery of compounds to specific environments

  • Creating synthetic biology devices based on AaeA components for programmable export

Table 6: Biotechnological Applications of Engineered AaeA Systems

ApplicationEngineering ApproachPotential AdvantagesTechnical Challenges
BioproductionOverexpression of native AaeABReduced product toxicityEnergy cost of efflux
Substrate specificity engineeringProduction of novel compoundsMaintaining transport efficiency
BiosensingPromoter-reporter fusionsSpecific detection of aromaticsBackground signal control
AaeR regulator engineeringTunable response characteristicsMaintaining sensor stability
BioremediationEnhanced export capacityImproved pollutant removalCellular energy limitations
Expanded substrate rangeTargeting specific contaminantsMaintaining cell viability
Synthetic BiologyAaeA domain swappingNovel transport functionsMaintaining proper folding
Stimulus-responsive systemsProgrammable export systemsComplex regulation

The application of AaeA in biotechnology will require careful optimization to balance the benefits of enhanced export with the metabolic costs of operating these energy-dependent transport systems.

What are the most promising approaches for targeting the AaeA efflux system to enhance antimicrobial efficacy against pathogenic E. coli strains?

While the AaeA-AaeB system primarily handles aromatic carboxylic acids rather than conventional antibiotics, targeting this system could still provide valuable strategies for combating resistant E. coli strains:

Direct Inhibition Strategies:

  • Structure-based design of AaeA-specific inhibitors targeting critical functional domains

  • Peptide inhibitors mimicking interface regions between AaeA and AaeB

  • Allosteric inhibitors that lock the pump in inactive conformations

  • Covalent inhibitors targeting conserved, accessible cysteine residues

Regulatory Disruption Approaches:

  • Antagonists of AaeR that prevent activation of aaeA expression

  • Compounds that interfere with inducer binding to AaeR

  • Antisense RNA or PNA strategies targeting aaeA mRNA

  • CRISPR-Cas delivery systems to disrupt aaeA gene expression

Metabolic Manipulation:

  • Compounds that mimic natural substrates but cause toxic accumulation

  • Metabolic inhibitors that increase production of toxic intermediates normally exported by AaeAB

  • Proton motive force disruptors that specifically impact AaeAB function

  • Membrane-targeting agents that disrupt the environment required for AaeAB assembly

Combination Therapies:

  • AaeAB inhibitors combined with conventional antibiotics

  • Targeting multiple efflux systems simultaneously (AaeAB, AcrAB-TolC)

  • Sequential administration strategies to prevent adaptation

  • Host-directed therapies combined with efflux inhibition

Table 7: Comparison of AaeA Targeting Strategies for Antimicrobial Enhancement

StrategyMechanismAdvantagesChallengesPotential Clinical Impact
Competitive InhibitorsSubstrate site bindingHigh specificityLimited to AaeAB substratesModerate (adjuvant potential)
Interface DisruptorsAaeA-AaeB interactionNovel mechanismDelivery to periplasmHigh (if effective)
Allosteric InhibitorsConformational lockingMay affect multiple stepsIdentifying binding sitesModerate to high
Regulatory AntagonistsAaeR functionPrevents pump expressionPotential off-target effectsModerate (stress response)
Metabolic PotentiatorsIncrease toxic substratesLeverages pump's normal roleMetabolic complexityHigh (unique mechanism)
Multi-target ApproachMultiple efflux systemsBroader spectrumDrug interaction complexityVery high (resistance barrier)

The development of these strategies requires detailed understanding of AaeA structure, function, and regulation, particularly in the context of pathogenic strains like E. coli O17:K52:H18. While challenging, successful approaches could provide valuable new tools against multidrug-resistant infections.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.