Recombinant Escherichia coli O17:K52:H18 Phosphoglycerol transferase I (mdoB)

Shipped with Ice Packs
In Stock

Description

Recombinant Production

Expression systems:

  • Hosts: Produced in E. coli, yeast, baculovirus, or mammalian cell systems .

  • Purity: ≥85% as confirmed by SDS-PAGE .

Strain-specificity:
The O17:K52:H18 serotype denotes a pathogenic E. coli variant, but recombinant MdoB production focuses on its conserved enzymatic function rather than serotype-specific traits .

Enzymatic Mechanism

Substrates and products:

SubstrateProductRole in MDO Biosynthesis
Phosphatidylglycerolsn-1,2-diglyceridePhosphoglycerol donor
Membrane-derived oligosaccharidesPhosphoglycerol-modified MDOsOsmoregulation
Arbutin (model substrate)Phosphoglycerol-arbutin adductIn vitro activity assay

Key steps:

  1. Phosphoglycerol transfer from phosphatidylglycerol to MDOs or arbutin.

  2. Diacylglycerol byproduct recycled via diacylglycerol kinase (dgk) to phosphatidic acid .

Genetic Mutants and Phenotypes

  • MdoB mutants (mdoB::Tn10, mdoB1):

    • Lack phosphoglycerol transferase I activity (<0.1 nmol/h per mg protein vs. 6.0 in wild type) .

    • Synthesize MDOs devoid of phosphoglycerol (<3% of wild-type levels) .

    • Resistant to arbutin-induced growth inhibition in dgk strains .

Applications and Significance

  • Biochemical research: Used to study MDO biosynthesis and osmoregulation in E. coli .

  • Industrial relevance: High-purity recombinant enzyme facilitates structural and mechanistic studies .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please specify your preference when placing the order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timeframes, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
mdoB; opgB; ECUMN_4982; Phosphoglycerol transferase I; Phosphatidylglycerol--membrane-oligosaccharide glycerophosphotransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-763
Protein Length
full length protein
Species
Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Target Names
mdoB
Target Protein Sequence
MSELLSFALFLASVLIYAWKAGRNTWWFAATLTVLGLFVVLNITLFASDYFTGDGINDAV LYTLTNSLTGAGVSKYILPGIGIVLGLTAVFGALGWILRRRRHHPHHFGYSLLALLLALG SVDASPAFRQITELVKSQSRDGDPDFAAYYKEPSKTIPDPKLNLVYIYGESLERTYFDNE AFPDLTPELGALKNEGLDFSHTQQLPGTDYTIAGMVASQCGIPLFAPFEGNASASVSSFF PQNICLGDILKNSGYQNYFVQGANLRFAGKDVFLKSHGFDHLYGSEELKSVVADPHYRND WGFYDDTVLDEAWKKFEELSRSGQRFSLFTLTVDTHHPDGFISRTCNRKKYDFDGKPNQS FSAVSCSQENIATFINKIKASPWFKDTVIVVSSDHLAMNNTAWKYLNKQDRNNLFFVIRG DKPQQETLAVKRNTMDNGATVLDILGGDNYLGLGRSSLSGQSMSEIFLNIKEKTLAWKPD IIRLWKFPKEMKEFTIDQQKNMIAFSGSHFRLPLLLRVSDKRVEPLPESEYSAPLRFQLA DFAPRDNFVWVDRCYKMAQLWAPELALSTDWCVSQGQLGGQQIVQHVDKTTWKGKTAFKD TVIDMARYKGNVDTLKIVDNDIRYKADSFIFNVAGAPEEVKQFSGISRPESWGRWSNAQL GDEVKIEYKHPLPKKFDLVITAKAYGNNASRPIPVRVGNEEQTLVLGNEVTTTTLHFDNP TDADTLVIVPPEPVSTNEGNILGHSPRKLGIGMVEIKVVEREG
Uniprot No.

Target Background

Function
This enzyme transfers a phosphoglycerol residue from phosphatidylglycerol to the membrane-bound nascent glucan backbones.
Database Links
Protein Families
OpgB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Phosphoglycerol transferase I and what role does it play in E. coli?

Phosphoglycerol transferase I is an enzyme located in the inner, cytoplasmic membrane of Escherichia coli that catalyzes the transfer of phosphoglycerol residues from phosphatidylglycerol to membrane-derived oligosaccharides (MDOs) or to model substrates like arbutin (p-hydroxyphenyl-β-D-glucoside). The enzyme has its active site on the outer aspect of the inner membrane, allowing it to catalyze the transfer of phosphoglycerol residues to external substrates added to the growth medium . This positioning is critical for its biological function within the bacterial cell envelope.

How does the mdoB gene relate to other membrane biosynthesis genes?

The mdoB gene functions within a network of genes involved in bacterial membrane biosynthesis and maintenance. Several key relationships have been established:

  • mdoB and mdoH: While mdoB encodes phosphoglycerol transferase I, mdoH encodes a glucosyltransferase essential for MDO core synthesis. An mdoH mutation leads to the complete absence of MDOs, whereas an mdoB mutation results in MDOs lacking only phosphoglycerol modifications . This distinction highlights the sequential nature of MDO biosynthesis, with mdoH acting earlier in the pathway.

  • mdoB and pgsA: Research has demonstrated connections between mdoB and the phosphatidylglycerol synthase gene (pgsA). The pgsA null mutant exhibits a thermosensitive growth defect, lysing at 42°C. This thermosensitivity appears to be related to the activation of the Rcs signal transduction system, which regulates capsular polysaccharide synthesis . The relationship suggests complex interactions between phospholipid biosynthesis, MDO modification, and stress response pathways.

  • mdoB and Rcs system: The Rcs phosphorelay signal transduction system, which includes components like RcsC, RcsF, YojN, and RcsB, is activated in membrane stress conditions. The relationship between mdoB function and Rcs activation provides insight into how bacteria monitor and respond to changes in membrane composition . This connection represents an important link between membrane structure and cellular signaling.

How can researchers distinguish between the functions of mdoB and other related transferases?

Distinguishing between mdoB and other related transferases requires a multi-faceted approach combining genetic, biochemical, and analytical techniques:

  • Genetic Complementation Tests: Transforming mdoB mutants with plasmids expressing either mdoB or other transferase genes can help determine functional specificity. Only the genuine mdoB gene will restore phosphoglycerol modification of MDOs in an mdoB mutant background .

  • Substrate Specificity Analysis: Phosphoglycerol transferase I (mdoB product) specifically uses phosphatidylglycerol as a donor and transfers phosphoglycerol groups to MDOs or arbutin. Other transferases will show different donor/acceptor preferences that can be biochemically characterized .

  • Arbutin Sensitivity Test: In strains with defective diglyceride kinase (dgk mutation), the presence of active phosphoglycerol transferase I leads to diglyceride accumulation when arbutin is added to the medium, causing growth inhibition. mdoB mutants show arbutin resistance in this background, providing a distinctive phenotype .

  • MDO Compositional Analysis: Mass spectrometry analysis of MDOs extracted from different transferase mutants can reveal specific modification patterns. MDOs from mdoB mutants specifically lack phosphoglycerol substituents while retaining other modifications .

  • Enzyme Localization: Using fluorescent protein fusions or subcellular fractionation techniques, researchers can determine the precise membrane localization of different transferases, which may contribute to their functional specificity.

What are the optimal conditions for expressing recombinant mdoB from E. coli O17:K52:H18?

Based on established protocols for recombinant protein expression in E. coli, the following conditions are recommended for optimal expression of phosphoglycerol transferase I:

  • Expression System Selection:

    • Host strain: E. coli BL21(DE3) is preferred due to its deficiency in certain proteases and optimization for protein expression .

    • Vector: pET-based expression systems with a C-terminal His-tag facilitate purification. The mdoB gene should be cloned into a vector like pET24b using appropriate restriction sites .

  • Growth and Induction Conditions:

    • Initial culture: Grow cells at 37°C for 18 hours in LB medium

    • Main culture: Inoculate at an OD580 of 0.1

    • Induction: Add IPTG (0.1 mM) when culture reaches OD580 of 0.5-0.8

    • Post-induction incubation: 30°C for 18 hours to balance expression level with protein solubility

  • Cell Harvest and Processing:

    • Adjust culture to OD580 of 3

    • Harvest cells by centrifugation

    • Resuspend in lysis buffer (20 mM NaH2PO4·2H2O, 500 mM NaCl, 10% (v/v) glycerol, pH 8.0)

    • Add lysozyme (5 mg/ml) and incubate on ice for 30 minutes

    • Disrupt cells using sonication (6 cycles, amplitude of 90, duty cycle of 50)

  • Protein Purification:

    • For His-tagged protein, use immobilized metal affinity chromatography (IMAC)

    • Include detergents or membrane-mimetic systems to maintain proper folding of this membrane-associated protein

    • Avoid harsh elution conditions that might compromise enzyme activity

The table below summarizes key parameters that should be optimized for maximizing active protein yield:

ParameterRange to TestOptimal ValueConsiderations
Induction Temperature16-37°C30°CLower temperatures generally favor proper folding
IPTG Concentration0.1-1.0 mM0.1 mMHigher concentrations may not improve yield
Induction Duration4-24 hours18 hoursBalance between expression and toxicity
Lysis MethodSonication, French press, EnzymaticSonicationMaintain gentleness to preserve activity
Detergent TypeDDM, LDAO, OGVariableMust be determined empirically

How can researchers detect and measure phosphoglycerol transferase I activity in vitro?

Phosphoglycerol transferase I activity can be detected and measured through several complementary approaches:

  • Arbutin Transfer Assay: This approach utilizes arbutin (p-hydroxyphenyl-β-D-glucoside) as a model substrate. The enzyme catalyzes the transfer of phosphoglycerol residues from phosphatidylglycerol to arbutin, resulting in phosphoglycerol diester derivatives of arbutin and the formation of sn-1,2-diglyceride . The reaction can be set up as follows:

    • Prepare reaction mixture containing:

      • Purified enzyme or membrane fraction

      • Phosphatidylglycerol (donor substrate)

      • Arbutin (acceptor substrate)

      • Buffer (typically 50 mM Tris-HCl, pH 7.5, 10 mM MgCl2)

    • Incubate at 30°C for 30-60 minutes

    • Extract lipids using chloroform-methanol methods

    • Analyze products by thin-layer chromatography or mass spectrometry

  • Direct MDO Modification Assay: This approach examines the physiological substrate:

    • Extract MDOs from cells or prepare synthetic MDO analogs

    • Incubate with the enzyme and phosphatidylglycerol

    • Analyze MDO phosphorylation using:

      • Chemical analysis of phosphate content

      • Mass spectrometry to detect specific phosphoglycerol modifications

      • Comparison between wild-type and mdoB mutant patterns

  • In Vivo Transfer to External Arbutin: This method takes advantage of the enzyme's active site orientation:

    • Add arbutin to growing cultures

    • In strains with active phosphoglycerol transferase I, phosphoglycerol will be transferred to arbutin

    • In dgk (diglyceride kinase) mutants, this leads to diglyceride accumulation and growth inhibition

    • mdoB mutations confer arbutin resistance in this background

  • Activity Quantification Methods:

    • Measure diglyceride formation using specific enzyme assays or lipid analysis

    • Quantify phosphoglycerol-arbutin using chromatographic separation and appropriate detection

    • Calculate enzyme activity as nmol product formed per minute per mg protein

What methods are most effective for studying the impact of mdoB mutations on membrane composition?

Several complementary approaches can be employed to comprehensively study how mdoB mutations affect membrane composition:

  • Lipid Extraction and Analysis:

    • Total lipid extraction using chloroform-methanol methods

    • Thin-layer chromatography (TLC) separation of phospholipids

    • Mass spectrometry analysis of phospholipid species

    • Quantification of specific lipids using colorimetric assays or HPLC

  • MDO Characterization:

    • Extraction of periplasmic contents using osmotic shock or gentle lysis

    • Size exclusion chromatography to isolate MDOs

    • Compositional analysis using:

      • Enzymatic digestion and chromatography

      • Mass spectrometry to identify and quantify modifications

      • NMR spectroscopy for detailed structural analysis

  • Membrane Physical Properties Assessment:

    • Fluorescence anisotropy to measure membrane fluidity

    • Differential scanning calorimetry to analyze phase transitions

    • Atomic force microscopy to examine membrane surface properties

    • Permeability assays using fluorescent dyes or small molecules

  • Genetic and Phenotypic Characterization:

    • Construction of defined mdoB mutants using CRISPR-Cas9 or recombineering

    • Complementation studies with plasmid-encoded mdoB

    • Growth analysis under various stress conditions (temperature, osmolarity)

    • Antibiotic susceptibility testing focusing on compounds that target cell envelope

The table below summarizes key differences typically observed between wild-type and mdoB mutant strains:

ParameterWild-type E. colimdoB MutantAnalytical Method
MDO Phosphoglycerol ContentPresentAbsentMass spectrometry
Membrane PermeabilityNormalSlightly increasedFluorescent dye uptake
Osmotic Stress ToleranceHighReducedGrowth curve analysis
Rcs System ActivationLowVariable/Context-dependentcpsB'-lac reporter
Antibiotic SusceptibilityBaselineAltered for certain antibioticsDisc diffusion assay

How does mdoB function interact with the Rcs signal transduction system?

The relationship between mdoB function and the Rcs signal transduction system reveals important insights into bacterial envelope stress responses and signal integration:

  • Envelope Integrity Sensing: The Rcs phosphorelay system is a complex signal transduction pathway in gram-negative bacteria that responds to envelope stress. Phosphoglycerol transferase I (mdoB product) contributes to proper MDO composition, and alterations in MDO phosphoglycerol content due to mdoB mutations may be sensed as envelope stress, potentially activating the Rcs system . This suggests that MDO modifications serve as signals for membrane integrity.

  • Genetic Interaction Evidence: Research has shown that mutations affecting phospholipid biosynthesis, particularly in the pgsA gene (encoding phosphatidylglycerol synthase), result in thermosensitive growth defects. Disruption of components of the Rcs system (rcsC, rcsF, yojN, rcsB) suppresses this thermosensitivity, indicating that inappropriate activation of Rcs signaling contributes to the growth defect . This genetic interaction provides strong evidence for functional connections between phospholipid metabolism, MDO modification, and Rcs signaling.

  • Experimental Monitoring System: The activation of the Rcs system can be monitored using a cpsB'-lac transcriptional fusion, as the Rcs system positively regulates cps genes for capsular polysaccharide synthesis. Using this reporter system, researchers have demonstrated that depletion of phosphatidylglycerol (the substrate for phosphoglycerol transferase I) leads to Rcs activation . When a strain with this fusion was grown with or without arabinose to control pgsA expression, colonies were blue (indicating Rcs activation) in the absence of arabinose and white (indicating no Rcs activation) in its presence.

  • Mechanistic Model: Based on these findings, a mechanistic model can be proposed:

    • Proper MDO phosphoglycerol modification by mdoB contributes to envelope integrity

    • Disruption of phosphatidylglycerol synthesis or mdoB function alters membrane properties

    • These alterations are detected by the Rcs system, particularly through the RcsF sensor component

    • Rcs activation triggers a transcriptional response affecting capsule synthesis, cell division, and other processes

    • In some contexts, this response can be detrimental, as evidenced by the suppression of pgsA thermosensitivity by rcs mutations

This understanding provides valuable insights into bacterial stress response networks and may inform strategies for developing antibiotics that target cell envelope biogenesis pathways.

What experimental design strategies should be employed when studying the effects of mdoB mutations on bacterial stress responses?

When studying how mdoB mutations affect bacterial stress responses, researchers should employ a systematic experimental design that controls variables and maximizes information yield:

  • Strain Construction and Validation:

    • Create precise mdoB deletion or point mutations using CRISPR-Cas9 or recombineering

    • Confirm mutations by sequencing and ensure no polar effects on neighboring genes

    • Construct complementation strains with wild-type mdoB expressed from a plasmid

    • Include multiple control strains (wild-type, vector-only, related gene mutants)

  • Stress Condition Matrix Design:

    • Test multiple stress conditions systematically:

      • Temperature stress (heat shock, cold shock)

      • Osmotic stress (high salt, high sucrose)

      • Membrane-targeting antibiotics at sub-MIC concentrations

      • Oxidative stress (H₂O₂, paraquat)

    • Use a range of stress intensities to establish dose-response relationships

    • Include time-course analyses to distinguish immediate from adaptive responses

  • Multi-Parameter Phenotypic Analysis:

    • Growth curve analysis using automated plate readers

    • Viability assessment using colony forming unit counts or live/dead staining

    • Microscopic examination of cell morphology

    • Membrane integrity assays using fluorescent dyes

    • Specific stress response reporter constructs (e.g., cpsB'-lac for Rcs activation)

  • Molecular and Biochemical Characterization:

    • Transcriptome analysis using RNA-seq to identify differentially expressed genes

    • Proteome analysis focusing on membrane and periplasmic proteins

    • Lipidome analysis to detect compensatory changes in membrane composition

    • MDO extraction and analysis to confirm loss of phosphoglycerol modifications

    • Enzymatic assays to verify the absence of phosphoglycerol transferase I activity

  • Statistical Design Considerations:

    • Include sufficient biological replicates (minimum n=3)

    • Use factorial design to identify interaction effects between mutation and stress conditions

    • Apply appropriate statistical tests (ANOVA, t-tests) to determine significance

    • Consider using Design of Experiments (DOE) approach to optimize experimental efficiency

The table below illustrates a sample experimental matrix for studying osmotic stress responses:

StrainNaCl ConcentrationTemperatureTime PointsMeasurements
Wild-type0%, 0.5%, 2%, 5%30°C, 42°C0, 30, 60, 120 minGrowth, MDO composition, Rcs activation
mdoB mutant0%, 0.5%, 2%, 5%30°C, 42°C0, 30, 60, 120 minGrowth, MDO composition, Rcs activation
Complemented0%, 0.5%, 2%, 5%30°C, 42°C0, 30, 60, 120 minGrowth, MDO composition, Rcs activation
mdoH mutant0%, 0.5%, 2%, 5%30°C, 42°C0, 30, 60, 120 minGrowth, MDO composition, Rcs activation

This systematic approach ensures that the specific effects of mdoB mutations can be distinguished from general stress responses and provides a comprehensive understanding of how phosphoglycerol transferase I activity contributes to bacterial stress adaptation.

How can Design of Experiments (DOE) be applied to optimize studies of mdoB function and expression?

Design of Experiments (DOE) provides a systematic framework for efficiently optimizing complex biological research, particularly valuable for studies involving recombinant protein expression and functional characterization of enzymes like phosphoglycerol transferase I:

  • Optimizing Recombinant Expression:
    When expressing recombinant phosphoglycerol transferase I, multiple factors affect protein yield and activity. Rather than testing each factor individually (one-factor-at-a-time approach), DOE allows systematic evaluation of multiple factors simultaneously :

    • Temperature (e.g., 18°C, 25°C, 30°C, 37°C)

    • IPTG concentration (e.g., 0.1 mM, 0.5 mM, 1.0 mM)

    • Induction time (e.g., early, mid, late log phase)

    • Post-induction incubation duration (e.g., 4h, 8h, 16h, 24h)

    Using a fractional factorial design would require only 16-20 experiments instead of 144 experiments for a full factorial design, while still identifying optimal conditions and important interactions .

  • Enzyme Activity Assay Optimization:
    DOE helps optimize phosphoglycerol transferase I activity assay conditions by investigating factors such as:

    • Buffer composition and pH

    • Substrate concentrations (phosphatidylglycerol, arbutin or MDOs)

    • Divalent cation requirements

    • Detergent type and concentration

    • Incubation time and temperature

    Response surface methodology can then create mathematical models to predict optimal conditions for maximum enzyme activity .

  • Overcoming Implementation Barriers:
    Several barriers to DOE implementation in biological research have been identified:

    • Complexity of statistical foundations

    • Difficulty in planning and executing complex experiments

    • Challenges in modeling multidimensional data

    These barriers can be addressed through:

    • Collaboration with statisticians

    • Use of specialized software for experimental design and analysis

    • Adoption of laboratory automation where possible

    • Training in DOE methodology

  • Example DOE Design for mdoB Research:

    FactorLow Level (-1)Center Point (0)High Level (+1)
    Temperature25°C30°C37°C
    IPTG0.1 mM0.5 mM1.0 mM
    MediaLBTBM9+glucose
    Induction OD0.40.81.2

    A central composite design using these factors would require 30 experimental runs rather than 81 for a full factorial design, while still allowing modeling of quadratic effects and identifying optimal conditions .

  • Analyzing Complex Interactions:
    DOE is particularly valuable for understanding how multiple variables affect mdoB function. For example, researchers can use it to explore how temperature, osmotic stress, and growth phase interact to influence the effects of mdoB mutations on membrane composition and stress responses. The resulting models can reveal non-intuitive interactions that would be difficult to discover through conventional experimental approaches .

By applying DOE principles, researchers can extract maximum information from minimal experiments, identify important factor interactions, and develop predictive models for mdoB function under various conditions, ultimately accelerating research progress.

How can inconsistent results in phosphoglycerol transferase I activity assays be resolved?

Inconsistencies in enzyme activity assays can arise from multiple sources. Here's a systematic approach to troubleshooting phosphoglycerol transferase I activity assays:

  • Enzyme Source Variability:

    • Problem: Batch-to-batch variation in recombinant protein preparation

    • Solution: Standardize expression and purification protocols; use consistent host strains and growth conditions; quantify protein concentration using multiple methods (Bradford, BCA, A280); assess protein purity by SDS-PAGE; include positive control preparations

  • Substrate Quality and Preparation:

    • Problem: Variability in phosphatidylglycerol or arbutin substrate quality

    • Solution: Source substrates from reliable suppliers; prepare fresh substrate solutions; verify substrate integrity using analytical methods (TLC, MS); include internal standards; ensure proper solubilization of lipid substrates using appropriate detergents or micelle systems

  • Membrane Environment Considerations:

    • Problem: Since phosphoglycerol transferase I is a membrane-associated enzyme, its activity depends on the membrane environment

    • Solution: For in vitro assays, optimize detergent type and concentration; consider using liposomes or nanodiscs to provide a more native-like environment; characterize lipid composition of membrane preparations; ensure consistent membrane protein extraction methods

  • Critical Assay Parameters:

    • Problem: Suboptimal or inconsistent reaction conditions

    • Solution: Systematically optimize and standardize:

      • Buffer composition and pH (typically 7.0-8.0)

      • Temperature (typically 30-37°C)

      • Incubation time (establish linearity)

      • Divalent cation requirements (Mg²⁺, Mn²⁺)

      • Detergent concentrations (if applicable)

  • Essential Controls:

    • No-enzyme controls to establish background rates

    • Heat-inactivated enzyme as negative control

    • Purified wild-type enzyme as positive control

    • Enzyme from mdoB mutant as specificity control

    • Internal standards for normalization of extraction or detection efficiency

  • Technical Troubleshooting Decision Tree:

    ObservationPossible CauseTesting ApproachSolution
    No activity in any sampleInactive enzymeTest with known active preparationOptimize protein expression and purification
    High variability between replicatesTechnical errors or heterogeneous samplesCheck pipetting accuracy; improve sample homogeneityUse automated liquid handling if available
    Activity decreases over timeEnzyme instabilityTest different storage conditionsAdd stabilizers; prepare fresh enzyme
    Substrate-dependent inconsistencySubstrate solubility issuesTest different solubilization methodsOptimize detergent type and concentration
    Detection method variabilityInterference or sensitivity issuesCompare multiple detection methodsSelect most robust method for routine use

By systematically addressing these potential sources of variability, researchers can develop robust, reproducible assays for phosphoglycerol transferase I activity that yield consistent and meaningful results across different experimental conditions.

What strategies can address challenges in purifying active recombinant phosphoglycerol transferase I?

Purifying active membrane-associated enzymes like phosphoglycerol transferase I presents several challenges that require specialized approaches:

  • Expression System Optimization:

    • Challenge: Low expression levels or inclusion body formation

    • Strategies:

      • Test multiple E. coli strains optimized for membrane protein expression (C41(DE3), C43(DE3))

      • Reduce expression rate using lower IPTG concentrations (0.05-0.1 mM) and lower temperatures (16-25°C)

      • Consider fusion tags that enhance solubility (MBP, SUMO, TrxA)

      • Evaluate co-expression with chaperones to assist proper folding

  • Membrane Protein Extraction:

    • Challenge: Efficiently extracting membrane-associated proteins while maintaining activity

    • Strategies:

      • Optimize cell disruption method (sonication parameters, pressure for homogenization)

      • Test different lysis buffers containing stabilizing agents (glycerol, reducing agents)

      • Consider gentle extraction using lysozyme followed by osmotic shock

      • Use specialized membrane protein extraction kits

  • Detergent Selection and Optimization:

    • Challenge: Finding detergents that solubilize the protein while maintaining activity

    • Strategies:

      • Screen multiple detergent classes (DDM, LDAO, OG, CHAPS)

      • Test detergent concentrations around and above critical micelle concentration

      • Consider detergent mixtures or protein-specific detergents

      • Evaluate lipid additives to stabilize the protein in solution

  • Purification Strategy Development:

    • Challenge: Maintaining protein stability and activity throughout purification

    • Strategies:

      • For His-tagged proteins, optimize imidazole concentrations to minimize non-specific binding without denaturing the target protein

      • Consider multi-step purification (IMAC followed by ion exchange or size exclusion)

      • Monitor activity at each purification step to identify problematic conditions

      • Include phospholipids or substrate analogs during purification to protect the active site

  • Reconstitution and Activity Preservation:

    • Challenge: Providing appropriate membrane environment for optimal activity

    • Strategies:

      • Test reconstitution into liposomes of varying composition

      • Evaluate nanodiscs or bicelles as alternative membrane mimetics

      • Optimize protein-to-lipid ratios for reconstitution

      • Consider mixed micelles with specific phospholipids

  • Comparative Purification Approaches:

    MethodAdvantagesDisadvantagesBest For
    Detergent extraction + IMACSimple, widely usedMay affect activityInitial screening
    Membrane isolation + detergent solubilizationMore native-like starting materialTime-consumingActivity preservation
    Styrene-maleic acid copolymer extractionExtracts protein with native lipidsLimited scalabilityStructural studies
    Cell-free expression into nanodiscsDirect incorporation into membrane mimeticTechnical complexityDifficult-to-express proteins

By systematically applying these strategies, researchers can overcome the challenges associated with purifying membrane proteins like phosphoglycerol transferase I, increasing the likelihood of obtaining active enzyme suitable for structural and functional studies. The approach must be tailored to the specific properties of the protein, with careful attention to maintaining the membrane environment required for proper folding and activity.

How should researchers interpret data showing varying levels of membrane-derived oligosaccharide phosphorylation in different experimental conditions?

Interpreting variations in MDO phosphorylation requires a nuanced approach that considers multiple factors affecting phosphoglycerol transferase I activity and the broader biological context:

By applying this comprehensive framework, researchers can extract meaningful biological insights from complex data on MDO phosphorylation patterns, advancing understanding of phosphoglycerol transferase I function in bacterial physiology and stress responses. This approach helps distinguish significant regulatory events from experimental artifacts or normal biological variation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.