Recombinant Escherichia coli O17:K52:H18 Potassium-transporting ATPase C chain (kdpC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
kdpC; ECUMN_0778; Potassium-transporting ATPase KdpC subunit; ATP phosphohydrolase [potassium-transporting] C chain; Potassium-binding and translocating subunit C; Potassium-translocating ATPase C chain
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-190
Protein Length
full length protein
Species
Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Target Names
kdpC
Target Protein Sequence
MRGLRPALSTFIFLLLITGGVYPLLTTALGQWWFPWQANGSLIREGDTVRGSALIGQNFT GNGYFHGRPSATAEMPYNPQASGGSNLAVSNPELDKLIAARVAALRAANPDASANVPVEL VTASASGLDNNITPQAAAWQIPRVAKARNLSVEQLTQLIAKYSQQPLVKYIGQPVVNIVE LNLALDKLDE
Uniprot No.

Target Background

Function
This protein is a component of the high-affinity ATP-driven potassium transport (Kdp) system. It catalyzes ATP hydrolysis coupled with the electrogenic transport of potassium ions into the cytoplasm. Specifically, this subunit functions as a catalytic chaperone, enhancing the ATP-binding affinity of the ATP-hydrolyzing subunit KdpB through the formation of a transient KdpB/KdpC/ATP ternary complex.
Database Links
Protein Families
KdpC family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the functional role of KdpC within the KdpFABC complex?

KdpC serves a critical regulatory function within the KdpFABC complex, which is responsible for high-affinity potassium transport in Escherichia coli. Based on structural and functional analyses, KdpC likely functions similarly to the β subunits found in Na+/K+ ATPase and gastric H+ ATPase systems. Its proximity to the selectivity filter and lack of significant conformational changes during the transport cycle suggests that KdpC primarily enhances K+ affinity rather than directly participating in the ion translocation mechanism. This hypothesis was initially proposed approximately three decades ago and has been supported by recent cryo-EM structural data .

How does the KdpFABC complex differ from other potassium transport systems?

The KdpFABC complex represents a unique chimeric system that combines features of both primary active P-type ATPases and ion channels. Unlike other members of the SKT (K+ transport) family, the KdpFABC complex achieves higher selectivity through a distinctive mechanism where K+ ions are redirected through the P-type ATPase subunit rather than following a traditional channel pore pathway. This arrangement allows the complex to effectively pump potassium ions against concentration gradients as high as 10^4, making it particularly valuable in low-potassium environments. The complex's evolutionary adaptation merges conserved protein architectures to create a highly specialized potassium transport system .

What are the key structural domains of the KdpC protein?

The KdpC protein functions as an auxiliary subunit within the KdpFABC complex, positioned strategically near the selectivity filter of KdpA. Structural studies have revealed that KdpC shares architectural similarities with β subunits of other transport systems. It contains transmembrane domains that interact with both KdpA and KdpB, stabilizing the complex and potentially enhancing the affinity for potassium ions. The protein's position relative to the selectivity filter suggests it plays a role in maintaining the optimal conformation for high-affinity potassium binding and transport efficiency .

What are the optimal expression conditions for recombinant KdpC in E. coli systems?

The expression of recombinant KdpC requires careful optimization of multiple parameters. Based on recent advances in recombinant protein production in E. coli, the following methodology is recommended:

Expression System Selection:

  • Use E. coli K-12 derivatives (such as BL21(DE3)) for high-level expression

  • Consider specialized strains for membrane protein expression if solubility issues arise

Culture Conditions:

  • Initial culture at 37°C until OD600 reaches 0.6-0.8

  • Reduce temperature to 18-25°C prior to induction to enhance proper folding

  • Use defined media supplemented with potassium to support KdpC functionality

Induction Parameters:

  • IPTG concentration: 0.1-0.5 mM (lower concentrations often yield better folding)

  • Post-induction cultivation time: 16-18 hours at reduced temperature

The optimization of these parameters should follow a Design of Experiments (DoE) approach rather than one-factor-at-a-time testing, as this allows for evaluation of parameter interactions and identification of optimal conditions with fewer experiments .

How can I apply Design of Experiments (DoE) to optimize KdpC expression?

Implementing a Design of Experiments approach for KdpC expression optimization offers significant advantages over traditional one-factor-at-a-time methods. The methodology should include:

  • Factor Identification: Identify critical parameters affecting KdpC expression, including temperature, induction timing, inducer concentration, media composition, and potassium levels.

  • Experimental Design Selection: For initial screening, employ a fractional factorial design to identify significant factors. For subsequent optimization, utilize response surface methodology (RSM) with a central composite design.

  • Response Variable Definition: Define clear quantitative measurements of success, such as protein yield (mg/L culture), purity (% by SDS-PAGE), and functional activity (K+ transport assays).

  • Statistical Analysis: Analyze results using statistical software to develop mathematical models that predict optimal conditions and identify interaction effects between factors.

This approach typically requires only 8-16 carefully designed experiments rather than dozens of one-factor-at-a-time experiments, reducing research time and costs while generating more reliable results .

What purification strategies are most effective for KdpC from recombinant E. coli?

Purification of KdpC requires specialized approaches due to its membrane-associated nature. An effective purification protocol includes:

Cell Lysis and Membrane Fraction Isolation:

  • Osmotic shock or mechanical disruption methods (French press/sonication)

  • Differential centrifugation to isolate membrane fractions (40,000-100,000 × g)

Solubilization:

  • Mild detergents (DDM, LMNG, or CHAPSO) at concentrations slightly above CMC

  • Addition of glycerol (10%) and potassium chloride to maintain stability

Chromatography Sequence:

  • Immobilized metal affinity chromatography (IMAC) using histidine tag

  • Size exclusion chromatography to remove aggregates and achieve high purity

  • Optional ion exchange chromatography based on isoelectric point of KdpC

Quality Assessment:

  • Purity verification by SDS-PAGE (>95%)

  • Functional assessment through reconstitution in liposomes and potassium transport assays

This purification strategy should be optimized using DoE approaches to maximize yield while maintaining functional integrity of the protein .

How can we effectively investigate the proposed mechanism of KdpC enhancing potassium affinity?

Investigating KdpC's role in enhancing potassium affinity requires multi-dimensional experimental approaches:

Mutagenesis Studies:

  • Targeted mutations of KdpC residues predicted to interact with the selectivity filter

  • Creation of chimeric constructs replacing KdpC with β subunits from related ATPases

Binding Affinity Measurements:

  • Isothermal titration calorimetry (ITC) with purified components

  • Surface plasmon resonance (SPR) with immobilized KdpFABC complexes

  • Fluorescence-based binding assays with labeled potassium analogs

Structural Analysis:

  • Hydrogen-deuterium exchange mass spectrometry to identify dynamic regions

  • Cryo-EM of KdpFABC complexes with and without KdpC under varying potassium concentrations

Functional Assays:

  • Potassium uptake measurements in reconstituted liposomes containing KdpFABC variants

  • Patch-clamp electrophysiology to measure transport kinetics with modified KdpC

The experimental data should be integrated into computational models of the transport mechanism to test the hypothesis that KdpC functions primarily to enhance binding affinity rather than directly participating in the transport process .

What approaches can resolve contradictory data regarding the metabolic burden of KdpC expression?

Resolving contradictions in metabolic burden data requires systematic experimental design that controls for multiple variables:

Standardized Expression Analysis:

  • Implement consistent protocols across laboratories

  • Use identical E. coli strains, vector systems, and growth conditions

  • Apply absolute quantification methods for transcript and protein levels

Multi-omics Integration:

  • Transcriptomics to identify differential gene expression patterns

  • Metabolomics to quantify changes in central carbon metabolism

  • Fluxomics to measure altered metabolic flux distributions

Time-resolved Measurements:

  • Capture dynamic responses from induction through stationary phase

  • Monitor growth rates, protein production, and metabolic markers simultaneously

Parameter Space Exploration:

  • Systematically vary expression levels using tunable promoters

  • Test multiple growth media formulations to identify media-specific effects

Data Integration Framework:

  • Develop computational models integrating experimental data

  • Apply machine learning approaches to identify patterns and dependencies

  • Consider applying artificial intelligence tools to clarify contradictory results

This comprehensive approach would generate uniform, systematic data that could be used to train AI models and resolve contradictions in the literature regarding metabolic burden associated with recombinant KdpC expression .

How can cryo-EM studies be optimized to resolve the complete conformational cycle of the KdpFABC complex?

Optimizing cryo-EM approaches to capture the full conformational cycle of the KdpFABC complex requires:

Sample Preparation Strategies:

  • Utilize nanodiscs or amphipols to maintain native-like membrane environment

  • Implement time-resolved cryo-EM by rapid freezing at defined time points after ATP addition

  • Apply GraFix method to stabilize transient conformational states

Data Collection Protocol:

  • Use beam-tilt pairs to collect data at multiple defocus values

  • Implement energy filtering to enhance contrast for membrane proteins

  • Apply dose fractionation with motion correction to minimize radiation damage

Conformational Trapping Approaches:

  • Introduce mutations to slow specific steps in the transport cycle

  • Use ATP analogs (AMP-PNP, ADP-AlF4) to trap specific catalytic states

  • Apply conformation-specific nanobodies as structural stabilizers

Image Processing Enhancement:

  • Implement 3D variability analysis to identify conformational heterogeneity

  • Apply neural network-based particle picking to identify rare conformations

  • Use multi-body refinement to resolve domain movements independently

This methodology would aim to capture the E1, E1P, E2-P, and E2 states, as well as transition states, providing a complete picture of the conformational changes that drive potassium transport through the combined half-channels formed by KdpA and KdpB .

What NIH Guidelines apply to research with recombinant E. coli expressing KdpC?

Research with recombinant E. coli expressing KdpC falls under specific regulatory frameworks:

Exemption Status:
E. coli K-12 derivatives used for KdpC expression are generally exempt from NIH Guidelines provided that:

  • The host does not contain conjugation-proficient plasmids or generalized transducing phages

  • Lambda or lambdoid or Ff bacteriophages or non-conjugative plasmids are used as vectors

  • Biosafety Level-1 (BSL-1) physical containment conditions are maintained

Non-exempt Categories:
The following research scenarios would not be exempt and would require IBC review:

  • Large-scale experiments exceeding 10 liters of culture

  • Experiments involving DNA from Risk Groups 3 or 4 organisms

  • Cloning of toxin molecule genes coding for vertebrate toxins

  • Experiments described in Section III-B of the NIH Guidelines

Implementation Requirements:

  • Register recombinant DNA work with your Institutional Biosafety Committee (IBC)

  • Document strain lineage to confirm K-12 derivation

  • Maintain proper laboratory records of all genetic modifications

  • Follow institutional biosafety protocols for handling recombinant organisms

Researchers should consult with their institutional biosafety officer to confirm the specific requirements applicable to their KdpC expression systems .

What are the recommended approaches for controlling plasmid stability in long-term KdpC expression systems?

Maintaining plasmid stability for long-term KdpC expression requires targeted strategies:

Selective Pressure Optimization:

  • Determine minimum effective antibiotic concentration to reduce metabolic burden

  • Consider non-antibiotic selection systems (auxotrophy complementation)

  • Implement alternating selection strategies for extended cultivation

Genetic Stability Enhancement:

  • Utilize low-copy number plasmids with stable origin of replication

  • Consider chromosomal integration for ultra-stable expression

  • Optimize codon usage to reduce translation burden and plasmid loss

Cultivation Strategies:

  • Monitor plasmid retention through regular sampling and PCR verification

  • Implement fed-batch cultivation to avoid nutrient limitation stress

  • Maintain cultures in exponential phase to reduce selective pressure for plasmid-free cells

Advanced Stabilization Technologies:

  • Post-segregational killing systems to eliminate plasmid-free cells

  • Toxin-antitoxin systems that ensure plasmid maintenance

  • CRISPR-based synthetic addiction modules for plasmid retention

These approaches can significantly enhance the stability of expression systems for long-term KdpC production, particularly for continuous cultivation systems or repeated batch processing .

How can researchers address poor KdpC expression or misfolding issues?

When encountering poor expression or misfolding of KdpC, implement a systematic troubleshooting approach:

Expression Optimization Matrix:

ParameterStandard ConditionOptimization RangeEvaluation Method
Temperature37°C15-30°CSDS-PAGE, Western blot
Induction OD6000.60.3-1.2Yield quantification
IPTG concentration1.0 mM0.01-0.5 mMSolubility analysis
Media compositionLBTB, 2YT, M9Growth curves, yield
Codon optimizationNativeOptimizedmRNA levels, translation efficiency
Fusion tagsHis6MBP, SUMO, TrxSolubility enhancement
Chaperone co-expressionNoneGroEL/ES, DnaK/JFolding assessment

Analytical Methods:

  • Use fluorescence-detection size-exclusion chromatography (FSEC) to assess protein folding

  • Apply limited proteolysis to evaluate structural integrity

  • Implement thermal shift assays to determine stability of expressed protein

Advanced Interventions:

  • Consider E. coli strains with enhanced membrane protein expression capability

  • Test detergent screening for optimal solubilization conditions

  • Evaluate the impact of potassium concentration in growth media on proper folding

This systematic approach allows researchers to efficiently identify and address factors contributing to poor KdpC expression or misfolding .

What are the best practices for assessing functional activity of recombinant KdpC?

Assessing the functional activity of recombinant KdpC requires multiple complementary approaches:

In Vitro Functional Assays:

  • Reconstitution in Proteoliposomes:

    • Incorporate purified KdpFABC complex into liposomes

    • Measure K+ uptake using fluorescent indicators (PBFI) or radioisotopes (86Rb+)

    • Assess ATP hydrolysis coupling to transport (P/O ratio)

  • Binding Affinity Studies:

    • Microscale thermophoresis to measure K+ binding constants

    • Competition assays with K+ analogs to determine specificity

    • Isothermal titration calorimetry for thermodynamic binding parameters

In Vivo Functional Tests:

  • Complementation Assays:

    • Transform kdpC-deficient E. coli strains with recombinant constructs

    • Evaluate growth under K+-limiting conditions

    • Measure intracellular K+ content using atomic absorption spectroscopy

  • Transport Activity Measurement:

    • Real-time monitoring of K+ uptake in whole cells

    • Membrane potential measurements using voltage-sensitive dyes

    • K+ efflux inhibition studies under varying conditions

Structure-Function Correlation:

  • Compare activity measurements with structural features determined by cryo-EM

  • Validate proposed mechanism through site-directed mutagenesis of key residues

  • Correlate functional data with computational simulations of transport mechanism

These approaches provide comprehensive assessment of whether recombinant KdpC is correctly folded and functional within the complete KdpFABC complex .

How can the KdpFABC complex serve as a model system for understanding P-type ATPase evolution?

The KdpFABC complex represents a valuable model system for evolutionary studies of transport mechanisms:

Evolutionary Analysis Framework:

  • Perform comprehensive phylogenetic analysis of KdpC across bacterial species

  • Compare sequence conservation patterns in KdpC to other P-type ATPase regulatory subunits

  • Identify key events in the evolutionary history of the KdpFABC complex

Chimeric Protein Engineering:

  • Create fusion proteins between KdpC and β subunits from other P-type ATPases

  • Test functionality of hybrid complexes to determine domain interchangeability

  • Map evolutionary constraints through systematic domain swapping experiments

Ancestral Sequence Reconstruction:

  • Computationally predict ancestral KdpC sequences at key evolutionary nodes

  • Express and characterize these reconstructed proteins to trace functional evolution

  • Test hypotheses about the emergence of specialized regulatory functions

Structural Comparison Studies:

  • Analyze structural similarities between KdpC and related regulatory subunits

  • Map co-evolutionary networks within the KdpFABC complex

  • Identify convergent evolution patterns across different transport systems

This research direction would provide insights into how the unique chimeric nature of the KdpFABC complex emerged through evolutionary processes and how specialized transport functions evolved from more general mechanisms .

What new methodologies show promise for advancing structural studies of the KdpFABC complex?

Emerging methodologies with high potential for advancing KdpFABC structural studies include:

Integrative Structural Biology Approaches:

  • Combine cryo-EM with mass spectrometry-based cross-linking (XL-MS)

  • Implement single-molecule FRET to capture dynamic conformational changes

  • Apply neutron scattering techniques to localize water and ions in the transport pathway

Advanced Computational Methods:

  • Implement molecular dynamics simulations spanning microsecond timescales

  • Apply enhanced sampling techniques to capture rare conformational transitions

  • Utilize machine learning for improved image classification in cryo-EM datasets

Innovative Sample Preparation:

  • Develop lipid nanodisc systems matching native E. coli membrane composition

  • Apply microfluidic technologies for time-resolved structural studies

  • Implement in situ structural studies within cellular environments

Emerging Biophysical Techniques:

  • Apply cryo-electron tomography for in-cell structural determination

  • Utilize microfocus serial crystallography for high-resolution structures

  • Implement 4D cryo-EM with time-resolved capabilities

These methodological advances would allow researchers to overcome current limitations in understanding the complete conformational cycle and ion permeation pathway of the KdpFABC complex, potentially resolving longstanding questions about the transport mechanism .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.