Recombinant Escherichia coli O17:K52:H18 Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE (arnE)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
arnE; ECUMN_2600; Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE; L-Ara4N-phosphoundecaprenol flippase subunit ArnE; Undecaprenyl phosphate-aminoarabinose flippase subunit ArnE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Target Names
arnE
Target Protein Sequence
MIWLTLVFASLLSVAGQLCQKQATCFVAINKRRKHIVLWLGLALACLGLAMVLWLLVLQN VPVGIAYPMLSLNFVWVTLAAVKLWHEPVSPRHWCGVAFIIGGIVILGSTV
Uniprot No.

Target Background

Function
This protein acts as a translocator, moving 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (alpha-L-Ara4N-phosphoundecaprenol) across the inner membrane of the cell, from the cytoplasm to the periplasm.
Database Links
Protein Families
ArnE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is ArnE and what is its role in bacterial antimicrobial resistance?

ArnE (previously designated PmrM) functions as a subunit of a membrane flippase that translocates 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (undecaprenyl phosphate-α-L-Ara4N) from the cytoplasmic to the periplasmic side of the inner bacterial membrane. This translocation is crucial for the modification of lipid A with L-Ara4N, which confers resistance to polymyxin and other cationic antimicrobial peptides in bacteria such as Escherichia coli and Salmonella typhimurium . The protein works in conjunction with ArnF (previously PmrL) to form what researchers believe is a complete flippase complex essential for antimicrobial resistance .

How is ArnE related to other proteins in the antimicrobial resistance pathway?

ArnE is encoded within a seven-gene operon (originally designated pmrHFIJKLM in Salmonella and later renamed arnBCADTEF) that is regulated by the PmrA transcription factor . This operon encodes proteins responsible for the biosynthesis, transport, and attachment of L-Ara4N to lipid A. The biosynthetic pathway begins with the modification of UDP-glucose by ArnA and ArnB, continues with further modifications by ArnC and ArnD, and concludes with the flipping of undecaprenyl phosphate-α-L-Ara4N by ArnE/ArnF and the transfer of L-Ara4N to lipid A by ArnT .

What experimental evidence supports ArnE's role as a flippase subunit?

Definitive evidence for ArnE's function comes from chromosomal inactivation studies. When arnE (pmrM) was inactivated in a polymyxin-resistant E. coli strain (with constitutively active pmrA), the bacteria became polymyxin-sensitive . Additionally, undecaprenyl phosphate-α-L-Ara4N in these mutants was less concentrated on the periplasmic surface of the inner membrane, as demonstrated by reduced labeling with the membrane-impermeable reagent N-hydroxysulfosuccinimidobiotin . Importantly, an arnT mutant maintained high levels of undecaprenyl phosphate-α-L-Ara4N similar to the parent strain, confirming that arnE specifically affects the translocation process rather than the biosynthesis of the substrate .

What structural features define ArnE as a membrane flippase component?

ArnE belongs to a class of membrane proteins involved in translocating lipid-linked substrates across biological membranes. While the detailed crystal structure of ArnE has not been extensively characterized in the provided materials, it likely shares features with other bacterial flippases, including multiple transmembrane domains that form a pathway for substrate movement across the membrane bilayer . The protein is specifically adapted to recognize and transport the relatively large undecaprenyl phosphate-α-L-Ara4N substrate across the inner membrane .

How does ArnE differ from other types of flippases in bacterial systems?

Unlike P4-ATPase lipid flippases found in eukaryotic systems (which use ATP hydrolysis to drive lipid translocation from the exoplasmic to the cytosolic leaflet ), ArnE appears to function without ATP dependence, suggesting a different mechanistic pathway for substrate translocation. ArnE specifically transports a complex aminoarabinose-modified lipid substrate, whereas other bacterial flippases may transport different lipid-linked substrates such as peptidoglycan precursors or O-antigen units . The specialized nature of ArnE's substrate specificity underscores its unique role in antimicrobial resistance pathways.

What experimental approaches can determine ArnE topology and transmembrane organization?

Researchers can employ multiple complementary techniques to characterize ArnE's membrane topology:

  • Site-directed labeling with membrane-impermeable reagents like N-hydroxysulfosuccinimidobiotin (as demonstrated in the literature) to identify domains exposed on different sides of the membrane

  • Cysteine scanning mutagenesis coupled with accessibility assays to map transmembrane regions

  • Fusion protein approaches with reporter enzymes like alkaline phosphatase or β-galactosidase

  • Advanced structural techniques including cryo-electron microscopy, which has successfully resolved structures of other membrane transporters such as P4-ATPases

What expression systems are optimal for recombinant ArnE production?

Based on successful approaches with similar membrane proteins, researchers should consider these expression systems:

  • E. coli-based expression: Using strains like BL21(DE3) with tunable promoters (T7, araBAD) allows control over expression rate, which is critical for proper membrane protein folding

  • Experimental design parameters: Successful expression requires optimization of multiple variables as demonstrated in factorial design studies for membrane proteins:

    • Induction at lower temperatures (25°C rather than 37°C)

    • Moderate inducer concentration (0.1 mM IPTG)

    • Induction at mid-log phase (OD600 of approximately 0.8)

    • Modified media composition (5 g/L yeast extract, 5 g/L tryptone, 10 g/L NaCl, 1 g/L glucose)

  • Co-expression strategies: Since ArnE likely functions with ArnF as a complex, co-expression of both proteins may improve stability and functional yield

How can researchers optimize soluble expression of membrane proteins like ArnE?

Membrane protein expression poses significant challenges. The following strategies have proven effective:

  • Fusion tags: N-terminal maltose-binding protein (MBP) or C-terminal green fluorescent protein (GFP) can enhance solubility and folding

  • Media supplementation: Addition of glycerol (5-10%) and specific ions may stabilize membrane proteins during expression

  • Controlled expression rate: Use of lower growth temperatures and reduced inducer concentrations minimizes aggregation

  • Factorial design approach: Systematic evaluation of multiple parameters simultaneously can identify optimal conditions, as demonstrated in studies of recombinant protein expression

What purification approaches yield functional ArnE protein?

For membrane proteins like ArnE, a multi-step purification strategy is recommended:

  • Membrane isolation: Careful cell lysis followed by differential centrifugation to isolate membrane fractions

  • Solubilization: Screening of detergents (LMNG, DDM, or CHAPS) at concentrations above their critical micelle concentration

  • Affinity chromatography: Using genetically incorporated tags (His6, Strep-tag II) followed by size exclusion chromatography

  • Activity validation: Functional assays to confirm that the purified protein maintains its native activity

Recent innovations like the Azo-tag system, which allows light-controlled protein purification under physiological conditions, may preserve membrane protein structure and function better than traditional methods requiring harsh elution conditions .

What assays can accurately measure ArnE flippase activity?

Several complementary approaches can assess ArnE flippase activity:

  • Membrane impermeant labeling: Using sulfo-NHS-biotin to quantify accessible substrate on the periplasmic face of the inner membrane

  • Reconstitution systems: Incorporation of purified ArnE into liposomes with fluorescently labeled lipid analogs to directly visualize translocation

  • Antimicrobial susceptibility testing: Functional complementation assays using polymyxin resistance as a phenotypic readout for proper ArnE function

  • Coupled enzymatic assays: Monitoring downstream modification of lipid A with L-Ara4N as an indirect measure of flippase activity

How can researchers distinguish between direct ArnE effects and indirect effects on membrane properties?

This critical question requires careful experimental design:

  • Site-directed mutagenesis: Generate point mutations in predicted active site residues versus control mutations in non-essential regions

  • Chimeric protein analysis: Create fusion proteins with domains from related flippases to identify specificity-determining regions

  • Substrate analog testing: Develop substrate analogs with modified chemical groups to probe specificity

  • Control experiments: Include proper controls using:

    • Inactive ArnE mutants

    • Related membrane proteins lacking flippase activity

    • Conditions that alter membrane fluidity independent of ArnE function

How does the ArnE-mediated pathway contribute to antimicrobial peptide resistance mechanisms?

The ArnE-facilitated modification of lipid A with L-Ara4N provides a molecular mechanism for antimicrobial resistance through several means:

  • Charge neutralization: L-Ara4N addition reduces the negative charge of lipid A, thereby decreasing the electrostatic interaction with cationic antimicrobial peptides like polymyxin

  • Membrane barrier enhancement: Modified lipid A alters membrane organization, potentially decreasing permeability to antimicrobial compounds

  • Cross-resistance effects: The modification pathway confers resistance to multiple classes of cationic antimicrobial peptides beyond polymyxins, including host defense peptides from the innate immune system

  • Versatility across infection types: The same resistance mechanism operates in diverse infection scenarios, including extraintestinal pathogenic E. coli (ExPEC) strains causing conditions ranging from urinary tract infections to pneumonia and osteomyelitis

Can ArnE be targeted for novel antimicrobial development?

ArnE represents a promising target for antimicrobial development based on several factors:

  • Essential role in resistance: Inactivation of arnE renders bacteria susceptible to polymyxins and potentially other antimicrobials

  • Absence in mammals: The L-Ara4N modification pathway is not present in mammalian cells, potentially allowing for selective targeting

  • Inhibition strategies: Potential approaches include:

    • Small molecule inhibitors targeting the ArnE-substrate interaction

    • Peptide-based inhibitors disrupting ArnE-ArnF complex formation

    • Compounds that compete with the natural substrate

  • Combination therapy potential: ArnE inhibitors could be used to potentiate the effects of existing antimicrobials against resistant strains

How can contradictory findings about ArnE function be reconciled through experimental design?

When facing contradictory research findings related to ArnE function, researchers should:

  • Standardize experimental conditions: Different growth conditions, strain backgrounds, and assay methods can yield contradictory results

  • Apply holistic thinking approaches: Research shows that individuals with holistic thinking styles are more able to reconcile contradictory information by considering that seemingly opposing statements might both contain truth under different conditions

  • Design experiments with factorial approaches: Systematically vary multiple parameters (temperature, medium composition, expression time) to identify condition-dependent effects

  • Examine strain-specific effects: Different E. coli strains (including various pathogenic variants like O1/O2:K1:H7, O18:K1:H7, and O11/O17/O77:K52:H18) may show distinct behaviors in ArnE function

  • Consider protein-protein interactions: ArnE likely functions as part of a complex with ArnF and potentially other membrane components, so examining isolated components might yield incomplete or contradictory results

What emerging technologies could advance understanding of ArnE function?

Several cutting-edge approaches show promise for ArnE research:

  • Cryo-electron microscopy: This technique has successfully resolved structures of membrane transporters and could provide detailed structural information about the ArnE/ArnF complex

  • Artificial intelligence approaches: Machine learning methods combined with structural data can predict protein-substrate interactions and identify potential binding sites for inhibitors

  • CRISPR-Cas9 genome editing: Precise modification of chromosomal arnE could generate subtle mutants to dissect function in the native context

  • Single-molecule tracking: Following individual ArnE complexes in live cells could reveal dynamics of flippase activity not apparent in bulk assays

  • Nanodiscs and lipid bilayer systems: Reconstitution of purified ArnE into defined membrane environments allows precise control of lipid composition and measurement of activity

How does ArnE compare structurally and functionally with eukaryotic flippases?

Understanding the similarities and differences between bacterial and eukaryotic flippases can provide evolutionary insights and potential therapeutic opportunities:

  • Structural organization: Unlike P4-ATPases in eukaryotes that use ATP hydrolysis and require accessory subunits (like Cdc50p in yeast) , ArnE appears to function with just ArnF without ATP dependence

  • Substrate specificity: While eukaryotic P4-ATPases primarily flip phosphatidylserine and phosphatidylethanolamine , ArnE specifically transports the more complex undecaprenyl phosphate-α-L-Ara4N substrate

  • Regulatory mechanisms: Eukaryotic flippases like Drs2p in yeast are regulated by phosphatidylinositol-4 phosphate (PI4P) and autoinhibition mechanisms , whereas ArnE regulation appears linked to the PmrA transcriptional response

  • Experimental approaches: Techniques developed for eukaryotic flippases, such as the use of BeF3- to stabilize specific conformational states , might be adaptable to study ArnE

What are the most common challenges in recombinant ArnE expression and how can they be addressed?

Membrane protein expression frequently encounters these obstacles:

  • Toxicity to host cells: Strategies include:

    • Using tightly controlled inducible promoters

    • Employing specialized E. coli strains designed for toxic protein expression (C41/C43)

    • Reducing expression temperature to 25°C or lower

  • Inclusion body formation: Methods to improve solubility:

    • Optimization of expression conditions through factorial design approaches

    • Addition of chemical chaperones to growth media

    • Co-expression with molecular chaperones like GroEL/GroES

  • Poor functional yield: Approaches to enhance activity:

    • Co-expression with partner proteins (ArnF)

    • Addition of specific lipids during purification

    • Reconstitution in nanodiscs or liposomes with defined lipid composition

How can researchers validate that recombinant ArnE is properly folded and functional?

Multiple complementary approaches can confirm proper folding and function:

  • Thermal stability assays: Techniques like differential scanning fluorimetry can assess protein stability

  • Limited proteolysis: Properly folded membrane proteins show distinct proteolytic patterns compared to misfolded variants

  • Functional complementation: Ability to restore polymyxin resistance in arnE-deficient strains

  • Binding assays: Demonstration of specific interaction with substrate or partner proteins

  • Activity reconstitution: Incorporation into liposomes or nanodiscs followed by flippase activity measurement

What are promising future research directions for advancing ArnE understanding?

Several areas merit further investigation:

  • High-resolution structural studies: Cryo-EM or X-ray crystallography of the ArnE/ArnF complex would provide critical insights into mechanism

  • Substrate recognition determinants: Identification of specific amino acid residues involved in recognizing and translocating undecaprenyl phosphate-α-L-Ara4N

  • Inhibitor development: Rational design and screening for compounds that specifically disrupt ArnE function as potential antimicrobial adjuvants

  • Regulation mechanisms: Understanding how environmental signals influence arnE expression and activity beyond PmrA regulation

  • Cross-species variation: Comparative studies of ArnE from different bacterial pathogens to identify conserved and variable features

How might synthetic biology approaches enhance ArnE research?

Synthetic biology offers novel strategies for ArnE investigation:

  • Designer expression systems: Creation of optimized expression cassettes with tunable promoters and codon optimization

  • Protein engineering: Development of fusion proteins with built-in reporters or affinity tags that don't disrupt function

  • Cell-free systems: In vitro reconstitution of the complete L-Ara4N modification pathway for mechanistic studies

  • Biosensor development: Engineering bacteria with fluorescent reporters linked to ArnE activity or antimicrobial resistance

  • Non-canonical amino acid incorporation: Introduction of spectroscopic probes or reactive groups at specific positions for detailed mechanistic studies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.