Recombinant Escherichia coli O17:K52:H18 Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF (arnF)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Full Length Escherichia coli O17:K52:H18 Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF(arnF) Protein, His-Tagged, is a recombinant protein expressed in E. coli . The protein is tagged with N-terminal His for purification and detection purposes .

  • Product Overview: The recombinant protein corresponds to the full-length ArnF protein from Escherichia coli O17:K52:H18 .

  • Synonyms:

    • Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF

    • L-Ara4N-phosphoundecaprenol flippase subunit ArnF

    • Undecaprenyl phosphate-aminoarabinose flippase subunit ArnF

Gene and Protein Information

  • Gene Name: arnF

  • Ordered Locus Names: ECUMN_2601

  • Uniprot ID: B7N5M4

  • AA Sequence: MGLMWGLFSVIIASAAQLSLGFAASHLPPMTHLWDFIAALLAFGLDARILLLGLLGYLLS VFCWYKTLHKLALSKAYALLSMSYVLVWIASMILPGWEGTFSLKALLGVACIMSGLmLIF LPTTKQRY

  • Expression Region: 1-128 aa (full length)

Function and Role

ArnF is a component of the ArnBCADTEF operon, which is crucial for the synthesis and transfer of 4-amino-4-deoxy-L-arabinose (L-Ara4N) . L-Ara4N is a modification added to the lipid A moiety of lipopolysaccharide (LPS) in Gram-negative bacteria . This modification helps the bacteria to resist cationic antimicrobial peptides, thereby contributing to bacterial survival and virulence . ArnF functions as a flippase, translocating L-Ara4N-phosphoundecaprenol across the inner membrane .

Structure

ArnF belongs to the family of proteins that utilize an interswitch toggle mechanism for activation . This mechanism involves communication between the N-terminus and the nucleotide-binding site, which is essential for its function .

Applications

Recombinant ArnF protein is useful in several applications:

  • ELISA: It can be used as an antigen in Enzyme-Linked Immunosorbent Assays (ELISA) for the detection and quantification of anti-ArnF antibodies .

  • Research: It serves as a valuable tool for studying the structure, function, and interactions of ArnF .

  • Drug Discovery: It can be employed in screening and identifying potential inhibitors of ArnF, which could lead to the development of new antimicrobial agents .

Related Products

  • Antibodies: Antibodies specific to E. coli ArnF are available for immunological studies.

  • ELISA Kits: ELISA kits based on Recombinant Escherichia coli O17:K52:H18 Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF(arnF) are available .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline for customers.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
arnF; ECUMN_2601; Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF; L-Ara4N-phosphoundecaprenol flippase subunit ArnF; Undecaprenyl phosphate-aminoarabinose flippase subunit ArnF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-128
Protein Length
full length protein
Species
Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Target Names
arnF
Target Protein Sequence
MGLMWGLFSVIIASAAQLSLGFAASHLPPMTHLWDFIAALLAFGLDARILLLGLLGYLLS VFCWYKTLHKLALSKAYALLSMSYVLVWIASMILPGWEGTFSLKALLGVACIMSGLMLIF LPTTKQRY
Uniprot No.

Target Background

Function

This protein functions as a probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (α-L-Ara4N-phosphoundecaprenol) flippase subunit, translocating α-L-Ara4N-phosphoundecaprenol across the inner membrane from the cytoplasm to the periplasm.

Protein Families
ArnF family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the ArnF protein and what is its role in Escherichia coli?

ArnF functions as a subunit of the 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase complex in Escherichia coli. This protein is part of a system that modifies bacterial lipopolysaccharide (LPS) by facilitating the addition of 4-amino-4-deoxy-L-arabinose (Ara4N) residues to lipid A. The primary function of ArnF is to facilitate the flipping of Ara4N from the cytoplasmic to the periplasmic side of the inner membrane.

The process involves several coordinated steps:

  • Biosynthesis of Ara4N in the cytoplasm

  • Attachment to undecaprenyl phosphate carrier lipid

  • Flipping of this complex across the inner membrane (facilitated by ArnF/ArnE)

  • Transfer of Ara4N to lipid A by ArnT transferase

This modification reduces the negative charge of the bacterial outer membrane, which can decrease the binding affinity of certain antibiotics, particularly cationic antimicrobial peptides and some β-lactams like ampicillin .

How does ArnF contribute to antimicrobial resistance in bacteria?

The ArnF protein plays a crucial role in modifying bacterial cell surface charge, which directly impacts antibiotic resistance. The modification pathway involving ArnF contributes to resistance through several mechanisms:

  • Charge Reduction: Ara4N residues "have been linked to antibiotic resistance due to reduction of the negative charge in the lipid A and core regions of the bacterial lipopolysaccharide (LPS)" . This reduction decreases the binding affinity of cationic antibiotics.

  • Polymyxin Resistance: The Ara4N modification is particularly important for resistance to polymyxins and other cationic antimicrobial peptides that target the bacterial membrane.

  • β-lactam Resistance: While β-lactam resistance often involves β-lactamases, studies have shown that "resistance of pathogenic strains of Escherichia coli to β-lactams, particularly to ampicillin, is on the rise and it is attributed to intrinsic and acquired mechanisms" . The ArnF-mediated pathway represents one such intrinsic mechanism.

  • Multi-drug Resistance: The ArnF pathway often works in concert with other resistance mechanisms. "One important factor contributing to resistance, together with primarily resistance mechanisms, is a mutation and/or an over-expression of the intrinsic efflux pumps in the resistance-nodulation-division (RND) superfamily" .

The prevalence of this resistance mechanism highlights the importance of monitoring ampicillin-resistant E. coli and developing alternative therapeutic approaches .

How does the expression of arnF correlate with antibiotic resistance phenotypes?

The relationship between arnF expression and antibiotic resistance reveals complex patterns that researchers must carefully analyze:

  • Variable Expression Patterns: Each bacterial isolate may display unique characteristics in terms of gene expression and resistance profiles. "Each E. coli isolate displayed unique characteristics, differing in minimum inhibitory concentration (MIC) values, prevalence of acquired blaTEM and blaCTX-M genes, and expression of the RND-family pumps" . Similar variability likely exists for arnF expression.

  • Strain-Specific Responses: The response to antibiotics varies significantly among strains. "These clinical isolates employed distinct intrinsic or acquired resistance pathways for their defense against ampicillin" .

  • Expression Analysis Methods: Quantification of arnF expression typically employs real-time qPCR, similar to methods used for other resistance-related genes: "Real-time qPCR was used to determine the expression of the selected efflux pumps acrA, acrB, tolC, and acrD and the repressor acrR after the exposure of E. coli to ampicillin" .

  • Correlation with MIC Values: Researchers often correlate gene expression with phenotypic resistance measured by minimum inhibitory concentration (MIC) determination for various antibiotics .

The complex relationship between arnF expression and resistance highlights the need for comprehensive analysis that considers multiple resistance mechanisms simultaneously.

How should researchers design experiments to study ArnF function?

Designing experiments to investigate ArnF function requires careful consideration of several factors:

  • Gene Expression Analysis:

    • Design specific primers for arnF detection

    • Implement real-time qPCR methodology similar to that used for RND family genes

    • Include appropriate reference genes for normalization

    • Analyze expression under various conditions (antibiotic exposure, pH changes, etc.)

  • Functional Studies:

    • Create gene knockout or knockdown strains

    • Express recombinant protein for in vitro studies

    • Assess changes in antimicrobial susceptibility using MIC determination

  • Structural Analysis:

    • Express and purify recombinant ArnF with appropriate tags

    • Consider expression conditions: "Recombinant Full Length protein was expressed in E. coli" with an N-terminal His tag

    • Optimize buffer conditions: "Tris/PBS-based buffer, 6% Trehalose, pH 8.0"

  • Activity Assays:

    • Study "the enzymatic transfer of Ara4N onto lipid A, which is catalysed by the ArnT transferase"

    • Detect "product formation by TLC and LC-ESI-QTOF mass spectrometry"

    • Test substrate specificity using synthesized analogues

  • Data Collection and Analysis:

    • Design appropriate data tables with independent and dependent variables311

    • Perform multiple trials to ensure reproducibility: "we have to do things multiple times to get an average"11

    • Apply proper statistical analysis to interpret results

What control groups and experimental conditions are essential for ArnF studies?

When investigating ArnF function, appropriate controls and conditions are critical:

Control TypeExamplesPurpose
Positive ControlsWild-type E. coli strains, E. coli ATCC 25922 Establish baseline ArnF activity
Negative ControlsArnF knockout strains, Key residue mutantsDemonstrate loss of function
Vector ControlsEmpty vector transformantsControl for expression system effects
Treatment ControlsVarious antibiotic concentrationsEstablish dose-response relationships

Experimental Conditions to Consider:

  • Growth Phase: ArnF expression may vary with bacterial growth phase

  • Medium Composition: Nutrient availability affects gene expression

  • pH Conditions: Low pH often triggers resistance mechanisms

  • Antibiotic Exposure: Pre-exposure to sub-inhibitory concentrations may induce expression

  • Temperature: Expression and activity may be temperature-dependent

For gene expression studies, researchers should follow established protocols: "Real-time qPCR was used to determine the expression of the selected efflux pumps... after the exposure of E. coli to ampicillin" . Similar approaches can be applied to arnF.

For protein studies, storage and handling conditions are critical: "Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles" .

What are the most reliable methods for purifying recombinant ArnF protein?

Purifying membrane proteins like ArnF requires specialized approaches to maintain structure and function:

  • Expression Systems:

    • E. coli-based expression: "Recombinant Full Length protein fused to N-terminal His tag, was expressed in E. coli"

    • Consider using modified strains optimized for membrane protein expression

    • Control expression levels to prevent aggregation (lower temperature, reduced inducer)

  • Purification Strategy:

    • Affinity chromatography using His-tag: "Tag: His"

    • Gentle membrane solubilization with appropriate detergents

    • Size exclusion chromatography to ensure homogeneity

    • Monitor purity: "Greater than 90% as determined by SDS-PAGE"

  • Buffer Optimization:

    • Use stabilizing additives: "Tris/PBS-based buffer, 6% Trehalose, pH 8.0"

    • For storage: "add 5-50% of glycerol (final concentration) and aliquot for long-term storage"

    • "Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL"

  • Quality Control Measures:

    • Verify protein identity via mass spectrometry or western blotting

    • Assess secondary structure integrity using circular dichroism

    • Confirm activity using functional assays before downstream applications

Membrane protein purification remains challenging, and conditions must be optimized for each specific construct and application.

How can researchers effectively measure the flippase activity of ArnF in vitro?

Measuring flippase activity presents technical challenges but several approaches provide reliable results:

  • Substrate Preparation:

    • Chemical synthesis of Ara4N derivatives: "we chemically synthesised a series of anomeric phosphodiester-linked lipid Ara4N derivatives"

    • Include both natural substrates and fluorescently labeled analogues

    • Consider specificity requirements: "only the α-neryl derivative was accepted by the Burkholderia cenocepacia ArnT protein"

  • Reconstituted Systems:

    • Prepare proteoliposomes with purified ArnF

    • Use "crude membranes from a deep-rough mutant from Escherichia coli as acceptor"

    • Control lipid composition to match native environment

  • Detection Methods:

    • "Product formation was detected by TLC and LC-ESI-QTOF mass spectrometry"

    • Fluorescence-based assays for real-time monitoring

    • Radiolabeled substrate tracking for high sensitivity

  • Data Analysis:

    • Determine kinetic parameters (Km, Vmax) for substrate transport

    • Compare wild-type and mutant ArnF to identify essential residues

    • Analyze inhibition patterns with potential inhibitors

  • Validation Approaches:

    • Correlate in vitro activity with in vivo antimicrobial resistance

    • Confirm directionality of transport using asymmetric vesicles

    • Test specificity using various substrate analogues

These methodologies provide complementary information and should be selected based on the specific research question being addressed.

How should researchers analyze and interpret data from ArnF expression studies?

  • Experimental Design Considerations:

    • Plan appropriate statistical approaches before data collection

    • Use factorial designs when examining multiple variables: "The full factorial of n factors applied to an experimental design (CRD, RCBD and LSD) is common"

    • Consider repeated measures designs for time-course studies

  • Data Organization:

    • Create well-structured data tables: "we need to think about what are you going to be doing in your lab, what's your independent variable and how many different types of tests are you gonna do with that particular variable"11

    • Include all relevant metadata and experimental conditions

    • Organize your independent and dependent variables clearly

  • Statistical Analysis:

    • Compare expression levels between different strains or conditions

    • Apply appropriate tests (t-tests, ANOVA, non-parametric alternatives)

    • Include measures of variability and effect size

  • Visualization Approaches:

    • "Only graph the averages cuz drafting everybody else gets real monkey, my averages tell me this is kind of the best data of what happened in my lab"11

    • Create clear figures with proper labels and units

    • Consider heat maps for complex expression patterns

  • Correlation Analysis:

    • Relate expression to phenotypic data (MIC values)

    • Consider multivariate approaches for complex datasets

    • Look for patterns across multiple genes in the pathway

  • Interpretation Guidelines:

    • Consider biological significance beyond statistical significance

    • Compare findings to existing literature on antimicrobial resistance

    • Acknowledge limitations and potential confounding factors

How should researchers approach conflicting data regarding ArnF and antimicrobial resistance?

When faced with conflicting results in ArnF research, a systematic approach is essential:

  • Examine Methodological Differences:

    • Variation in strain backgrounds or growth conditions

    • Different measurement techniques or experimental designs

    • Temporal aspects of resistance development

  • Consider Multiple Resistance Mechanisms:

    • ArnF is one of many potential resistance factors

    • "Clinical isolates employed distinct intrinsic or acquired resistance pathways for their defense against ampicillin"

    • Presence of β-lactamases may dominate the resistance phenotype

  • Analyze Genetic Context:

    • Sequence variations in arnF between strains

    • Regulatory differences affecting expression

    • Presence of other resistance genes may mask ArnF effects

  • Design Validation Studies:

    • Create defined genetic backgrounds to isolate ArnF effects

    • Use complementation studies to confirm function

    • Test resistance under standardized conditions

  • Formulate Research Questions:

    • Turn conflicts into new research questions: "Think about what questions you have or that currently exist about your topic"

    • "Think about the 5 W's –who, what, when, where, and why– to help you brainstorm different ways"

    • Design experiments specifically to address contradictions

  • Develop a Conceptual Framework:

    • "Create a concept map of your topic that consists of all of the possible aspects and angles of your topic"

    • Place conflicting results within this framework

    • Identify potential moderating variables

The complex nature of antimicrobial resistance mechanisms means that seemingly contradictory results may reflect different aspects of a multifaceted process.

How can ArnF be targeted for novel antimicrobial strategies?

The essential role of ArnF in antimicrobial resistance makes it a promising target for new therapeutic approaches:

  • Inhibitor Development Strategies:

    • Structure-based drug design using ArnF sequence information

    • High-throughput screening for potential inhibitors

    • Development of substrate analogues as competitive inhibitors

  • Combination Therapy Approaches:

    • ArnF inhibitors could sensitize resistant bacteria to existing antibiotics

    • Address the need for "ampicillin alternatives" by restoring efficacy

    • Target multiple resistance mechanisms simultaneously

  • Substrate-Based Approaches:

    • Design molecules based on substrate specificity studies: "Out of seven analogues tested, only the α-neryl derivative was accepted"

    • Create non-flippable substrate analogues that compete with natural substrates

    • Develop covalent inhibitors targeting active site residues

  • Expression Regulation:

    • Target pathways that regulate arnF expression

    • Interfere with sensing mechanisms that upregulate the Arn pathway

    • Design antisense or siRNA approaches to reduce expression

  • Species-Specific Targeting:

    • Leverage structural differences between ArnF in different bacterial species

    • Design narrow-spectrum inhibitors to reduce impact on commensal bacteria

    • Focus on pathogens with high resistance rates

  • Challenges to Address:

    • Membrane permeability of inhibitor compounds

    • Potential for development of resistance to ArnF inhibitors

    • Toxicity concerns for compounds targeting membrane processes

The development of ArnF inhibitors represents a promising approach to combat the increasing problem of antimicrobial resistance, particularly in "pathogenic strains of Escherichia coli" where "resistance to β-lactams, particularly to ampicillin, is on the rise" .

What are the most promising research questions for advancing our understanding of ArnF?

To advance knowledge of ArnF and its role in bacterial physiology and antimicrobial resistance, researchers should consider these key questions:

Researchers should approach these questions using the PICO framework (Population, Intervention, Control, Outcomes) to formulate testable hypotheses . This structured approach will help advance our understanding of this important antimicrobial resistance mechanism.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.