Recombinant Full Length Escherichia coli O17:K52:H18 Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF(arnF) Protein, His-Tagged, is a recombinant protein expressed in E. coli . The protein is tagged with N-terminal His for purification and detection purposes .
Product Overview: The recombinant protein corresponds to the full-length ArnF protein from Escherichia coli O17:K52:H18 .
Synonyms:
AA Sequence: MGLMWGLFSVIIASAAQLSLGFAASHLPPMTHLWDFIAALLAFGLDARILLLGLLGYLLS VFCWYKTLHKLALSKAYALLSMSYVLVWIASMILPGWEGTFSLKALLGVACIMSGLmLIF LPTTKQRY
ArnF is a component of the ArnBCADTEF operon, which is crucial for the synthesis and transfer of 4-amino-4-deoxy-L-arabinose (L-Ara4N) . L-Ara4N is a modification added to the lipid A moiety of lipopolysaccharide (LPS) in Gram-negative bacteria . This modification helps the bacteria to resist cationic antimicrobial peptides, thereby contributing to bacterial survival and virulence . ArnF functions as a flippase, translocating L-Ara4N-phosphoundecaprenol across the inner membrane .
ArnF belongs to the family of proteins that utilize an interswitch toggle mechanism for activation . This mechanism involves communication between the N-terminus and the nucleotide-binding site, which is essential for its function .
Recombinant ArnF protein is useful in several applications:
ELISA: It can be used as an antigen in Enzyme-Linked Immunosorbent Assays (ELISA) for the detection and quantification of anti-ArnF antibodies .
Research: It serves as a valuable tool for studying the structure, function, and interactions of ArnF .
Drug Discovery: It can be employed in screening and identifying potential inhibitors of ArnF, which could lead to the development of new antimicrobial agents .
This protein functions as a probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (α-L-Ara4N-phosphoundecaprenol) flippase subunit, translocating α-L-Ara4N-phosphoundecaprenol across the inner membrane from the cytoplasm to the periplasm.
ArnF functions as a subunit of the 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase complex in Escherichia coli. This protein is part of a system that modifies bacterial lipopolysaccharide (LPS) by facilitating the addition of 4-amino-4-deoxy-L-arabinose (Ara4N) residues to lipid A. The primary function of ArnF is to facilitate the flipping of Ara4N from the cytoplasmic to the periplasmic side of the inner membrane.
The process involves several coordinated steps:
Biosynthesis of Ara4N in the cytoplasm
Attachment to undecaprenyl phosphate carrier lipid
Flipping of this complex across the inner membrane (facilitated by ArnF/ArnE)
Transfer of Ara4N to lipid A by ArnT transferase
This modification reduces the negative charge of the bacterial outer membrane, which can decrease the binding affinity of certain antibiotics, particularly cationic antimicrobial peptides and some β-lactams like ampicillin .
The ArnF protein plays a crucial role in modifying bacterial cell surface charge, which directly impacts antibiotic resistance. The modification pathway involving ArnF contributes to resistance through several mechanisms:
Charge Reduction: Ara4N residues "have been linked to antibiotic resistance due to reduction of the negative charge in the lipid A and core regions of the bacterial lipopolysaccharide (LPS)" . This reduction decreases the binding affinity of cationic antibiotics.
Polymyxin Resistance: The Ara4N modification is particularly important for resistance to polymyxins and other cationic antimicrobial peptides that target the bacterial membrane.
β-lactam Resistance: While β-lactam resistance often involves β-lactamases, studies have shown that "resistance of pathogenic strains of Escherichia coli to β-lactams, particularly to ampicillin, is on the rise and it is attributed to intrinsic and acquired mechanisms" . The ArnF-mediated pathway represents one such intrinsic mechanism.
Multi-drug Resistance: The ArnF pathway often works in concert with other resistance mechanisms. "One important factor contributing to resistance, together with primarily resistance mechanisms, is a mutation and/or an over-expression of the intrinsic efflux pumps in the resistance-nodulation-division (RND) superfamily" .
The prevalence of this resistance mechanism highlights the importance of monitoring ampicillin-resistant E. coli and developing alternative therapeutic approaches .
The relationship between arnF expression and antibiotic resistance reveals complex patterns that researchers must carefully analyze:
Variable Expression Patterns: Each bacterial isolate may display unique characteristics in terms of gene expression and resistance profiles. "Each E. coli isolate displayed unique characteristics, differing in minimum inhibitory concentration (MIC) values, prevalence of acquired blaTEM and blaCTX-M genes, and expression of the RND-family pumps" . Similar variability likely exists for arnF expression.
Strain-Specific Responses: The response to antibiotics varies significantly among strains. "These clinical isolates employed distinct intrinsic or acquired resistance pathways for their defense against ampicillin" .
Expression Analysis Methods: Quantification of arnF expression typically employs real-time qPCR, similar to methods used for other resistance-related genes: "Real-time qPCR was used to determine the expression of the selected efflux pumps acrA, acrB, tolC, and acrD and the repressor acrR after the exposure of E. coli to ampicillin" .
Correlation with MIC Values: Researchers often correlate gene expression with phenotypic resistance measured by minimum inhibitory concentration (MIC) determination for various antibiotics .
The complex relationship between arnF expression and resistance highlights the need for comprehensive analysis that considers multiple resistance mechanisms simultaneously.
Designing experiments to investigate ArnF function requires careful consideration of several factors:
Gene Expression Analysis:
Functional Studies:
Structural Analysis:
Activity Assays:
Data Collection and Analysis:
Design appropriate data tables with independent and dependent variables311
Perform multiple trials to ensure reproducibility: "we have to do things multiple times to get an average"11
Apply proper statistical analysis to interpret results
When investigating ArnF function, appropriate controls and conditions are critical:
Experimental Conditions to Consider:
Growth Phase: ArnF expression may vary with bacterial growth phase
Medium Composition: Nutrient availability affects gene expression
pH Conditions: Low pH often triggers resistance mechanisms
Antibiotic Exposure: Pre-exposure to sub-inhibitory concentrations may induce expression
Temperature: Expression and activity may be temperature-dependent
For gene expression studies, researchers should follow established protocols: "Real-time qPCR was used to determine the expression of the selected efflux pumps... after the exposure of E. coli to ampicillin" . Similar approaches can be applied to arnF.
For protein studies, storage and handling conditions are critical: "Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles" .
Purifying membrane proteins like ArnF requires specialized approaches to maintain structure and function:
Expression Systems:
Purification Strategy:
Buffer Optimization:
Quality Control Measures:
Verify protein identity via mass spectrometry or western blotting
Assess secondary structure integrity using circular dichroism
Confirm activity using functional assays before downstream applications
Membrane protein purification remains challenging, and conditions must be optimized for each specific construct and application.
Measuring flippase activity presents technical challenges but several approaches provide reliable results:
Substrate Preparation:
Chemical synthesis of Ara4N derivatives: "we chemically synthesised a series of anomeric phosphodiester-linked lipid Ara4N derivatives"
Include both natural substrates and fluorescently labeled analogues
Consider specificity requirements: "only the α-neryl derivative was accepted by the Burkholderia cenocepacia ArnT protein"
Reconstituted Systems:
Detection Methods:
Data Analysis:
Determine kinetic parameters (Km, Vmax) for substrate transport
Compare wild-type and mutant ArnF to identify essential residues
Analyze inhibition patterns with potential inhibitors
Validation Approaches:
Correlate in vitro activity with in vivo antimicrobial resistance
Confirm directionality of transport using asymmetric vesicles
Test specificity using various substrate analogues
These methodologies provide complementary information and should be selected based on the specific research question being addressed.
Experimental Design Considerations:
Data Organization:
Create well-structured data tables: "we need to think about what are you going to be doing in your lab, what's your independent variable and how many different types of tests are you gonna do with that particular variable"11
Include all relevant metadata and experimental conditions
Organize your independent and dependent variables clearly
Statistical Analysis:
Compare expression levels between different strains or conditions
Apply appropriate tests (t-tests, ANOVA, non-parametric alternatives)
Include measures of variability and effect size
Visualization Approaches:
"Only graph the averages cuz drafting everybody else gets real monkey, my averages tell me this is kind of the best data of what happened in my lab"11
Create clear figures with proper labels and units
Consider heat maps for complex expression patterns
Correlation Analysis:
Relate expression to phenotypic data (MIC values)
Consider multivariate approaches for complex datasets
Look for patterns across multiple genes in the pathway
Interpretation Guidelines:
Consider biological significance beyond statistical significance
Compare findings to existing literature on antimicrobial resistance
Acknowledge limitations and potential confounding factors
When faced with conflicting results in ArnF research, a systematic approach is essential:
Examine Methodological Differences:
Variation in strain backgrounds or growth conditions
Different measurement techniques or experimental designs
Temporal aspects of resistance development
Consider Multiple Resistance Mechanisms:
Analyze Genetic Context:
Sequence variations in arnF between strains
Regulatory differences affecting expression
Presence of other resistance genes may mask ArnF effects
Design Validation Studies:
Create defined genetic backgrounds to isolate ArnF effects
Use complementation studies to confirm function
Test resistance under standardized conditions
Formulate Research Questions:
Develop a Conceptual Framework:
The complex nature of antimicrobial resistance mechanisms means that seemingly contradictory results may reflect different aspects of a multifaceted process.
The essential role of ArnF in antimicrobial resistance makes it a promising target for new therapeutic approaches:
Inhibitor Development Strategies:
Structure-based drug design using ArnF sequence information
High-throughput screening for potential inhibitors
Development of substrate analogues as competitive inhibitors
Combination Therapy Approaches:
Substrate-Based Approaches:
Expression Regulation:
Target pathways that regulate arnF expression
Interfere with sensing mechanisms that upregulate the Arn pathway
Design antisense or siRNA approaches to reduce expression
Species-Specific Targeting:
Leverage structural differences between ArnF in different bacterial species
Design narrow-spectrum inhibitors to reduce impact on commensal bacteria
Focus on pathogens with high resistance rates
Challenges to Address:
Membrane permeability of inhibitor compounds
Potential for development of resistance to ArnF inhibitors
Toxicity concerns for compounds targeting membrane processes
The development of ArnF inhibitors represents a promising approach to combat the increasing problem of antimicrobial resistance, particularly in "pathogenic strains of Escherichia coli" where "resistance to β-lactams, particularly to ampicillin, is on the rise" .
To advance knowledge of ArnF and its role in bacterial physiology and antimicrobial resistance, researchers should consider these key questions:
Researchers should approach these questions using the PICO framework (Population, Intervention, Control, Outcomes) to formulate testable hypotheses . This structured approach will help advance our understanding of this important antimicrobial resistance mechanism.