Recombinant Escherichia coli O17:K52:H18 Probable intracellular septation protein A (yciB)

Shipped with Ice Packs
In Stock

Description

Protein Characteristics

The recombinant yciB protein consists of 179 amino acids (UniProt ID: B7N467) with a molecular weight of approximately 20 kDa. Key features include:

PropertySpecification
Expression SystemEscherichia coli
TagN-terminal His-tag
Purity>85% by SDS-PAGE
Storage Conditions-20°C in Tris-based buffer with 50% glycerol
Sequence CoverageFull-length (1-179aa)
Structural DomainsFive transmembrane regions

The protein exhibits an α-helical structure with predicted membrane-spanning segments between residues 15-37, 45-67, 73-95, 102-124, and 130-152 .

Functional Role in Bacterial Physiology

Experimental studies reveal yciB's essential functions:

Membrane Integrity Maintenance

  • Interacts with cell division complexes (FtsZ, FtsA) and elongation machinery (MreB)

  • Synergizes with DcrB to prevent inner membrane-peptidoglycan aberrant linkages

  • Maintains proper lipopolysaccharide (LPS) levels through unknown mechanisms

Stress Response

  • ΔyciB mutants show 85% reduced viability under low osmolarity conditions

  • Induces Cpx envelope stress response pathway when absent

Key Research Findings

Recent investigations demonstrate critical aspects of yciB function:

Study FocusMethodologyKey Results
Protein InteractionsBacterial two-hybridIdentified 12 interaction partners including FtsZ, MreB, and SecD
Membrane DynamicsCryo-EM tomographyRevealed membrane invagination phenotypes in ΔyciB/ΔdcrB mutants
Structural AnalysisPhyre2 modelingPredicted three extracellular loops critical for protein interactions

The protein's absence leads to:

  • 40% increase in membrane vesiculation

  • 2.5-fold elevation of outer membrane lipoprotein Lpp accumulation

  • Complete growth arrest at 42°C

Biotechnological Applications

Commercial variants (e.g., Creative Biomart RFL32170EF) feature:

  • Lyophilized stability for long-term storage

  • Compatibility with ELISA and Western blot applications

  • Batch-specific activity ranges of 1-5 mg/mL protein concentration

Critical handling requirements:

  • Reconstitution in sterile PBS (pH 7.4)

  • Avoidance of repeated freeze-thaw cycles

  • Short-term storage at 4°C with 0.01% sodium azide

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary based on the purchasing method or location. For specific delivery times, kindly consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipment, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference for your convenience.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
yciB; ECUMN_1553; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-179
Protein Length
full length protein
Species
Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Target Names
yciB
Target Protein Sequence
MKQFLDFLPLVVFFAFYKIYDIYAATAALIVATAIVLIYSWVRFRKVEKMALITFVLVVV FGGLTLFFHNDEFIKWKVTVIYALFAGALLVSQWVMKKPLIQRMLGKELTLPQPVWSKLN LAWAVFFILCGLANIYIAFWLPQNIWVNFKVFGLTALTLIFTLLSGIYIYRHMPQEDKS
Uniprot No.

Target Background

Function
This protein plays a crucial role in cell envelope biogenesis, maintaining cell envelope integrity, and regulating membrane homeostasis.
Database Links
Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the membrane topology of YciB in Escherichia coli?

YciB is an inner membrane protein with five transmembrane domains. The membrane topology has been experimentally verified using a dual pho-lac reporter system. This approach determines whether the C-terminus of the protein resides in the cytoplasm or periplasm by expressing the protein from cloned genes in E. coli strain DH5α (phoA-lacZ-ΔM15) carrying the pKTop plasmid . The topology analysis confirms the predicted structure of YciB with five membrane-spanning domains, providing essential structural information for understanding its function in the bacterial cell envelope.

How conserved is YciB across bacterial species?

YciB contains a domain of unknown function (DUF1043) and is highly conserved across gamma-proteobacteria. Sequence analysis reveals that YciB homologs are present in most Gram-negative bacterial species . The high degree of conservation suggests an essential role in bacterial physiology. The conservation pattern primarily follows taxonomic relationships, with the highest conservation observed within the Enterobacteriaceae family. This evolutionary conservation supports the hypothesis that YciB performs a fundamental function in bacterial cell envelope biogenesis.

What is the relationship between YciB and ZapG?

Based on recent structural and functional studies, researchers have proposed renaming YciB to ZapG (Z-ring-associated protein G) to better reflect its functional role. This nomenclature change is based on evidence that YciB/ZapG interacts with components of the divisome, particularly linking the Z-ring to septal peptidoglycan-synthesizing complexes . The crystal structure of the cytosolic domain of Haemophilus ducreyi YhcB (ZapG) at 2.8 Å resolution reveals a unique tetrameric α-helical coiled-coil structure, which likely organizes interprotein oligomeric interactions on the inner surface of the cytoplasmic membrane .

How can researchers express and purify recombinant YciB for structural studies?

Expression and purification of YciB present challenges due to its multiple transmembrane domains. A successful approach involves:

  • Vector selection: Use expression vectors with strong inducible promoters (e.g., pET series) for controlled expression

  • Host strain optimization: E. coli BL21(DE3) or C41(DE3) strains are recommended for membrane protein expression

  • Induction conditions: Low temperature induction (16-18°C) with reduced IPTG concentration (0.1-0.2 mM)

  • Membrane extraction: Two-step solubilization using mild detergents (DDM or LDAO)

  • Purification strategy: Immobilized metal affinity chromatography followed by size exclusion chromatography

For structural studies, researchers should consider using the cytosolic domain alone (as demonstrated in the 2.8 Å crystal structure obtained from H. ducreyi YhcB), which is more amenable to crystallization than the full-length protein with transmembrane domains .

What methods can be used to study YciB protein interactions in vivo?

Several complementary approaches have proven effective for studying YciB interactions:

  • Bacterial two-hybrid system: This has successfully identified interactions between YciB and proteins involved in cell elongation and division. The system allows detection of protein-protein interactions in their native cellular environment .

  • Co-immunoprecipitation: Using epitope-tagged YciB to pull down interaction partners, followed by mass spectrometry identification.

  • Fluorescence microscopy: Fluorescent protein fusions (such as GFP-YciB) can reveal co-localization with other divisome components.

  • Cross-linking studies: Chemical cross-linking coupled with mass spectrometry can capture transient interactions.

Research has demonstrated that YciB interacts with various proteins involved in cell elongation (e.g., RodZ, RodA) and cell division (e.g., FtsI, FtsQ, ZipA), with seven of these interactions conserved across species including Yersinia pestis and Vibrio cholerae .

How can researchers generate and characterize yciB deletion mutants?

Creating and characterizing yciB deletion mutants involves:

  • Mutant construction:

    • Lambda Red recombineering system for precise gene deletion

    • Confirmation by PCR and sequencing to verify clean deletion

  • Phenotypic characterization:

    • Growth curve analysis under various conditions (temperature, osmolarity)

    • Microscopy to assess cell morphology and division defects

    • Fluorescent D-amino acid labeling to visualize peptidoglycan synthesis

  • Complementation studies:

    • Expression of YciB from an inducible plasmid to confirm phenotype specificity

    • Point mutations in conserved residues to identify functional domains

Deletion of yciB has been shown to result in shorter cell length compared to wild type, while overexpression causes cell elongation. Additionally, ΔyciB strains show impaired FtsZ ring formation and hypersensitivity to cell wall-acting antibiotics, supporting YciB's role in cell division and envelope integrity .

How does YciB influence FtsZ ring formation and stability?

YciB appears to play a critical role in proper FtsZ ring assembly and stability, although the molecular mechanism remains incompletely understood. Immunolabeling studies with FtsZ-specific antibodies in ΔyciB cells have demonstrated that the Z-ring is not assembled properly or stably in the absence of YciB . This is not due to FtsZ degradation, as its cellular concentration in ΔyciB cells remains sufficient for Z-ring formation.

Research indicates that YciB may function as a scaffolding protein that links the Z-ring to septal peptidoglycan-synthesizing complexes. The unique tetrameric α-helical coiled-coil structure of YciB's cytosolic domain could provide multiple interaction interfaces for divisome components . Further research using site-directed mutagenesis of specific residues involved in protein-protein interactions, combined with high-resolution imaging techniques such as STORM or PALM microscopy, could elucidate the precise mechanism by which YciB influences Z-ring dynamics.

What is the molecular basis for the synthetic lethal interaction between yciB and dcrB?

The synthetic lethal interaction between yciB and dcrB reveals a critical functional relationship in outer membrane protein biogenesis. The double mutant (ΔyciB ΔdcrB) is non-viable primarily due to malfunction in the biogenesis of proteins destined for the outer membrane . These proteins become trapped at the inner membrane, exerting toxic effects on the cell that result in activation of diverse cell envelope stress response signaling mechanisms and ultimately cell death.

Mechanistically, the synthetic lethality appears to involve:

  • Disruption of inner-to-outer membrane protein transport

  • Accumulation of mislocalized outer membrane proteins at the inner membrane

  • Membrane stress leading to loss of envelope integrity

  • Activation of stress response pathways unable to compensate for the defect

This genetic interaction suggests that YciB and DcrB function in parallel or partially redundant pathways essential for proper protein trafficking to the outer membrane. Research approaches combining transcriptomics, membrane proteomics, and in vivo protein tracking could further elucidate this critical cellular process .

How does YciB interact with ZipA and what is the functional significance?

YciB directly interacts with ZipA, an essential cell division protein, which may indicate involvement in cell envelope synthesis directed by ZipA in a PBP3-independent manner . The specific interacting domains have been mapped through bacterial two-hybrid analysis and in vitro binding studies.

The functional significance of this interaction appears to be:

  • Coordination of septal peptidoglycan synthesis with Z-ring constriction

  • Proper localization of cell division machinery

  • Recruitment of additional division proteins to the septum

In ΔyciB mutants, the septum localization of ZipA is disturbed, suggesting that YciB influences the spatial organization of ZipA during cell division . This mislocalization may contribute to the observed cell division defects in yciB mutants. Future studies using cryo-electron tomography combined with site-specific crosslinking approaches could provide structural insights into the YciB-ZipA interaction at the divisome.

How can researchers overcome difficulties in detecting YciB expression?

YciB is a low-abundance membrane protein, which presents challenges for detection. Effective strategies include:

  • Optimized extraction methods:

    • Use specialized membrane protein extraction buffers

    • Include protease inhibitors to prevent degradation

    • Employ gentle solubilization with appropriate detergents (DDM, LDAO, or C12E8)

  • Enhanced detection techniques:

    • Epitope tagging (His, FLAG, or HA) for improved antibody detection

    • Use of highly sensitive chemiluminescence or fluorescence-based Western blot systems

    • Membrane fraction enrichment prior to analysis

  • Expression system considerations:

    • Use low-copy number vectors to avoid toxicity from overexpression

    • Consider inducible promoters with tight regulation

    • Balance expression level with protein functionality

When working with tagged versions of YciB, researchers should verify that the tag does not interfere with protein function by performing complementation assays in yciB deletion strains to confirm that tagged protein can rescue mutant phenotypes.

What strategies can address the challenges of studying synthetic lethal interactions involving yciB?

Studying synthetic lethal interactions like yciB-dcrB requires specialized approaches:

  • Conditional expression systems:

    • Use of temperature-sensitive alleles

    • Depletion strains with inducible promoters

    • Degron-based protein degradation systems

  • Sequential gene deletion approaches:

    • Introduction of a complementing plasmid before deletion

    • CRISPR interference (CRISPRi) for temporary knockdown

    • Partial loss-of-function alleles to study intermediate phenotypes

  • High-throughput screening methods:

    • Synthetic genetic array (SGA) analysis

    • Transposon-sequencing (Tn-seq) to identify suppressors

    • Chemical genomic profiling to identify condition-specific interactions

For the yciB-dcrB interaction specifically, researchers have successfully employed complementation with plasmid-expressed YciB under control of an inducible promoter, allowing for controlled depletion studies to observe the progression of cellular defects leading to lethality .

How can specificity be ensured when studying YciB interactions with divisome components?

Ensuring specificity when studying YciB interactions requires multiple validation approaches:

  • Control experiments:

    • Use structurally similar but functionally unrelated membrane proteins as negative controls

    • Include known interaction partners as positive controls

    • Test interactions in multiple bacterial strain backgrounds

  • Validation across methods:

    • Confirm bacterial two-hybrid results with co-immunoprecipitation

    • Validate in vitro interactions with in vivo co-localization studies

    • Use FRET or BiFC to confirm proximity in living cells

  • Functional validation:

    • Construct point mutations in predicted interaction interfaces

    • Assess effects of mutations on both interaction and phenotype

    • Perform suppressor screens to identify compensatory mutations

Researchers have successfully mapped specific amino acid residues involved in YciB interactions with FtsI and RodZ using systematic mutagenesis approaches coupled with interaction assays , providing a framework for similar studies with other divisome components.

How might structural analysis of YciB inform drug development targeting bacterial cell division?

The unique structure of YciB presents opportunities for antimicrobial development:

  • Structure-based drug design:

    • The 2.8 Å crystal structure of the cytosolic domain reveals potential druggable pockets

    • The tetrameric α-helical coiled-coil structure provides multiple interaction interfaces

    • Conserved regions across bacterial species offer targets for broad-spectrum agents

  • Targeting protein-protein interactions:

    • Disruption of YciB interactions with essential division proteins

    • Small molecules that bind to interaction interfaces

    • Peptide mimetics based on key interacting regions

  • Functional consequences of inhibition:

    • Blocking YciB function could impair cell division

    • Disruption of envelope integrity

    • Potential synergy with existing antibiotics

The critical role of YciB in bacterial cell division, combined with its absence in mammalian cells, makes it an attractive target for novel antimicrobial development strategies targeting multi-drug resistant pathogens.

What is the relationship between YciB function and bacterial stress responses?

Evidence suggests YciB plays a role in bacterial stress adaptation:

  • Osmotic stress:

    • The ΔyciB mutant shows susceptibility to low osmolarity conditions

    • YciB may function in maintaining envelope integrity during osmotic fluctuations

    • Potential role in modulating membrane permeability

  • Stationary phase survival:

    • YciB appears to be needed for the transition from exponential to stationary growth

    • May coordinate cell division with nutrient availability

    • Potential involvement in stress-induced morphological changes

  • Antibiotic resistance:

    • ΔyciB strains show hypersensitivity to cell wall-acting antibiotics even in stationary phase

    • YciB may be involved in cell wall remodeling during stress

    • Connection to general stress response pathways

Research combining transcriptomics under various stress conditions with phenotypic characterization of yciB mutants could provide insights into how this protein contributes to bacterial adaptation and survival in changing environments.

How can advanced imaging techniques enhance our understanding of YciB dynamics during cell division?

Cutting-edge imaging approaches offer new insights into YciB function:

  • Super-resolution microscopy:

    • STORM or PALM microscopy to visualize YciB localization with nanometer precision

    • Multi-color imaging to track co-localization with other division proteins

    • Time-lapse imaging to follow dynamics throughout the cell cycle

  • Cryo-electron tomography:

    • Visualization of YciB in the native membrane environment

    • 3D reconstruction of the divisome complex

    • Structural changes during different stages of cell division

  • Live-cell imaging techniques:

    • FRAP (Fluorescence Recovery After Photobleaching) to measure YciB mobility

    • Single-molecule tracking to follow individual YciB proteins

    • Optogenetic approaches to temporally control YciB function

These advanced imaging approaches, combined with genetic and biochemical methods, would provide unprecedented insights into how YciB contributes to the dynamic process of bacterial cell division at the molecular level.

Protein-Protein Interactions Identified for YciB/ZapG

Table 1: Confirmed YciB/ZapG Protein Interaction Partners and Conservation

Interaction PartnerFunctionConfirmed in E. coliConserved in Y. pestisConserved in V. cholerae
FtsISeptal peptidoglycan synthesisYesYesYes
FtsQDivisome assemblyYesYesNo
ZipAZ-ring tetheringYesNoNo
RodZCell shape determinationYesYesYes
RodALateral peptidoglycan synthesisYesYesYes
MreBCytoskeletal proteinYesNoYes
DcrBInner membrane lipoproteinYesNoNo

Table based on bacterial two-hybrid analysis data from search results

Phenotypic Characteristics of yciB Mutants

Table 2: Comparative Phenotypic Analysis of ΔyciB Strain

Phenotypic TraitWild TypeΔyciB MutantReference
Cell LengthNormalShorter
FtsZ Ring FormationNormalImpaired
Septum FormationNormalDefective in majority of cells
Susceptibility to Low OsmolarityResistantSusceptible
Peptidoglycan Synthesis at SeptumNormalReduced labeled septa in elongated cells
Response to Cell Wall AntibioticsNormalHypersensitive
ZipA LocalizationNormal septum localizationDisturbed localization

Table compiled from multiple experimental studies cited in the search results

Structural Features of YciB/ZapG

Table 3: Key Structural Elements of YciB/ZapG

Structural FeatureDescriptionFunctional Significance
Transmembrane DomainsFive membrane-spanning helicesAnchoring in inner membrane
Cytosolic DomainTetrameric α-helical coiled-coilProtein-protein interactions
N-terminusLocated in cytoplasmInteraction with cytoplasmic proteins
C-terminusLocated in periplasmPotential sensing or signaling function
Parallel and Anti-parallel Coiled-CoilUnique combination in tetrameric structureOrganization of interprotein oligomeric interactions
Disordered Regions>30% of residues disordered in crystal structureConformational flexibility for multiple interactions

Table based on structural data from the 2.8 Å crystal structure described in search result

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.