Recombinant Escherichia coli O17:K52:H18 Probable ubiquinone biosynthesis protein UbiB (ubiB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Escherichia coli O17:K52:H18 Probable Ubiquinone Biosynthesis Protein UbiB (ubiB)

The Recombinant Escherichia coli O17:K52:H18 Probable ubiquinone biosynthesis protein UbiB (ubiB) is a genetically engineered version of the UbiB protein found in Escherichia coli. This protein plays a crucial role in the biosynthesis of ubiquinone (CoQ), a vital component of the bacterial respiratory chain. Ubiquinone is essential for energy production in bacteria, acting as an electron carrier in the electron transport chain.

Role of UbiB in Ubiquinone Biosynthesis

UbiB is involved in the first monooxygenase step of ubiquinone biosynthesis. It is part of an operon that includes other genes necessary for CoQ synthesis, such as ubiE, which encodes a C-methyltransferase required for both CoQ and menaquinone synthesis . Mutations in the ubiB gene lead to the accumulation of octaprenylphenol, a precursor in the CoQ biosynthetic pathway .

Characteristics of UbiB

  • Function: UbiB is crucial for the monooxygenase step in CoQ biosynthesis, potentially acting through a kinase-like mechanism to activate proteins necessary for this process .

  • Structure: UbiB belongs to a family of proteins with motifs similar to eukaryotic-type protein kinases, though its kinase activity and substrates are not fully understood .

  • Localization: In Escherichia coli, UbiB is associated with the membrane, where it participates in the biosynthesis of CoQ.

Recombinant Expression

Recombinant expression of UbiB involves cloning the ubiB gene into a suitable vector and expressing it in a host organism, often E. coli itself. This allows for large-scale production of the protein for research or biotechnological applications.

Accumulation of Intermediates

Mutant strains lacking functional UbiB accumulate octaprenylphenol, highlighting its role in CoQ biosynthesis .

Kinase Activity Speculation

There is speculation that UbiB might have kinase activity, potentially regulating the CoQ biosynthetic pathway by phosphorylating key proteins .

Aerobic vs. Anaerobic Conditions

The conversion of octaprenylphenol to CoQ is rapid under aerobic conditions, suggesting a regulatory mechanism that could involve UbiB .

Table 1: Accumulation of Intermediates in UbiB Mutants

Mutant StrainAccumulated Intermediate
ubiB(-)Octaprenylphenol
ubiD(-)3-octaprenyl-4-hydroxybenzoic acid

Table 2: Characteristics of UbiB

CharacteristicDescription
FunctionMonooxygenase step in CoQ biosynthesis
StructureSimilar to eukaryotic protein kinases
LocalizationMembrane-associated

References Identification of Escherichia coli ubiB, a Gene Required for the First... Global Molecular Epidemiology of the O15:K52:H1 Extraintestinal... Biosynthesis of ubiquinone in Escherichia coli K-12 Identification of Escherichia coli ubiB, a Gene Required for the First... speE - Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) Recombinant Escherichia coli...

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ubiB; ECUMN_4361; Probable protein kinase UbiB; Ubiquinone biosynthesis protein UbiB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-546
Protein Length
full length protein
Species
Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Target Names
ubiB
Target Protein Sequence
MTPGEVRRLYFIIRTFLSYGLDELIPKMRITLPLRLWRYSLFWMPNRHKDKPLGERLRLA LQELGPVWIKFGQMLSTRRDLFPPHIADQLALLQDKVAPFDGKLAKQQIEAAMGGLPVEA WFDDFEIKPLASASIAQVHTARLKSNGKEVVIKVIRPDILPVIKADLKLIYRLARWVPRL LPDGRRLRPTEVVREYEKTLIDELNLLRESANAIQLRRNFEDSPMLYIPEVYPDYCSEGM MVMERIYGIPVSDVAALEKNGTNMKLLAERGVQVFFTQVFRDSFFHADMHPGNIFVSYEH PENPKYIGIDCGIVGSLNKEDKRYLAENFIAFFNRDYRKVAELHVDSGWVPPDTNVEEFE FAIRTVCEPIFEKPLAEISFGHVLLNLFNTARRFNMEVQPQLVLLQKTLLYVEGVGRQLY PQLDLWKTAKPFLESWIKDQVGIPALVRAFKEKAPFWVEKMPELPELVYDSLRQGKYLQH SVDKIARELQSNHVRQGQSRYFLGIGATLVLSGTFLLVSRPEWGLMPGWLMAGGLIAWFV GWRKTR
Uniprot No.

Target Background

Function

This protein is likely a protein kinase regulator of UbiI activity, which is involved in the aerobic biosynthesis of coenzyme Q (ubiquinone).

Database Links
Protein Families
ABC1 family, UbiB subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is UbiB and what is its confirmed role in ubiquinone biosynthesis?

UbiB belongs to a large family of proteins containing motifs found in eukaryotic-type protein kinases, suggesting it may function as a kinase rather than directly as a monooxygenase . The current hypothesis is that UbiB may be involved in activating proteins necessary for the monooxygenase steps via phosphorylation, potentially regulating the ubiquinone biosynthesis pathway in response to environmental signals such as oxygen availability .

How does UbiB relate to homologous proteins in other organisms?

UbiB in E. coli is homologous to the aarF gene product in Providencia stuartii, with both proteins being required for coenzyme Q biosynthesis. Disruption mutants of both genes result in similar phenotypes, specifically the accumulation of octaprenylphenol and absence of coenzyme Q . This suggests conserved function across bacterial species.

UbiB is also considered to be homologous to the ABC1/COQ8 protein family in eukaryotes, particularly to the ABC1 protein in Saccharomyces cerevisiae, which is similarly required for ubiquinone biosynthesis . The evolutionary conservation of these proteins across diverse organisms underscores their fundamental importance in ubiquinone metabolism.

What experimental evidence established UbiB's role in ubiquinone biosynthesis?

The role of UbiB in ubiquinone biosynthesis was established through a combination of genetic and biochemical approaches:

  • Mutational analysis: Disruption of the ubiB gene in E. coli resulted in strains lacking coenzyme Q .

  • Metabolite accumulation: UbiB mutants accumulate octaprenylphenol, which is the substrate for the first monooxygenase step in the ubiquinone pathway .

  • Complementation studies: The phenotype of ubiB mutants can be complemented by expressing the P. stuartii aarF gene, confirming their functional equivalence .

  • Analysis of the original ubiB409 mutant strain (AN59) revealed it contained an IS1 element at position +516 of the ubiE gene, causing a polar mutation affecting the downstream ubiB gene, resulting in octaprenylphenol accumulation .

What are the optimal conditions for recombinant expression of soluble UbiB in E. coli?

Based on experimental design approaches for similar proteins in E. coli, the following conditions are recommended for optimal expression of soluble UbiB:

Table 1: Optimal Expression Conditions for Soluble Recombinant Proteins in E. coli

ParameterOptimal ConditionNotes
Growth medium5 g/L yeast extract, 5 g/L tryptone, 10 g/L NaCl, 1 g/L glucoseLow glucose concentration helps reduce metabolic burden
Induction OD6000.8Mid-logarithmic phase balances cell density and metabolic activity
Inducer concentration0.1 mM IPTGLow IPTG concentration reduces inclusion body formation
Post-induction temperature25°CLower temperatures slow protein synthesis and improve folding
Expression time4 hoursOptimizes balance between protein yield and solubility
Antibiotic concentration30 μg/mL kanamycinFor plasmid maintenance without excessive metabolic burden

These conditions have been shown to yield high levels (up to 250 mg/L) of soluble functional recombinant proteins in E. coli with approximately 75% homogeneity . For UbiB specifically, these parameters may require fine-tuning through multivariant analysis since UbiB contains kinase-like domains that may affect folding properties.

How can researcher differentiate between UbiB's putative kinase activity and its role in ubiquinone biosynthesis?

To investigate the dual aspects of UbiB function, researchers should employ a multifaceted approach:

  • Site-directed mutagenesis: Mutate conserved kinase domain residues to determine if kinase activity and ubiquinone biosynthesis can be uncoupled. Key residues in the ATP-binding motifs and catalytic domains should be targeted.

  • In vitro kinase assays: Using purified recombinant UbiB to detect phosphorylation activity on candidate substrates involved in ubiquinone biosynthesis, particularly proteins involved in monooxygenase reactions.

  • Phosphoproteomic analysis: Compare the phosphorylation profiles of wild-type and ubiB mutant strains to identify differentially phosphorylated proteins that might be UbiB substrates.

  • Conditional expression systems: Develop systems allowing rapid induction of UbiB expression followed by sampling at short time intervals to detect early phosphorylation events preceding changes in ubiquinone biosynthesis.

  • Protein-protein interaction studies: Use techniques such as bacterial two-hybrid systems, co-immunoprecipitation, or crosslinking approaches to identify proteins that physically interact with UbiB.

The putative kinase function of UbiB is supported by sequence analysis showing motifs found in eukaryotic-type protein kinases, but direct experimental evidence for kinase activity is still lacking .

What experimental approaches can resolve the current contradictions regarding UbiB's function in the hydroxylation steps?

The literature contains contradictions regarding UbiB's role in hydroxylation steps of ubiquinone biosynthesis. Initially, UbiB was thought to catalyze the first hydroxylation step, but more recent evidence suggests UbiI performs this function instead . To resolve these contradictions, researchers should consider:

  • Metabolomic profiling: Comprehensive analysis of accumulated intermediates in ubiB, ubiI, and double mutants using high-resolution LC-MS/MS to precisely identify the blocked steps.

  • In vitro reconstitution: Attempts to reconstitute the hydroxylation reactions using purified UbiB, UbiI, and other components to determine the minimal system required for activity.

  • Oxygen-18 labeling studies: Using 18O2 to track the incorporation of oxygen atoms during ubiquinone biosynthesis in various mutant backgrounds.

  • Time-course analysis: Following the conversion of intermediates during a shift from anaerobic to aerobic conditions in wild-type and mutant strains to establish the temporal sequence of reactions.

  • Structural biology approaches: Determining the three-dimensional structure of UbiB to identify whether it contains structural features consistent with monooxygenase activity or exclusively with kinase function.

These approaches can help establish whether UbiB directly catalyzes hydroxylation reactions or instead functions as a regulatory protein that controls these steps through phosphorylation of other proteins .

How should researchers design experiments to study UbiB using multivariant statistical methods?

When studying UbiB expression and function, multivariant statistical methods offer significant advantages over traditional univariant approaches. The recommended experimental design approach includes:

  • Fractional factorial design: For initial screening of multiple variables affecting UbiB expression or activity, a 2^(n-k) fractional factorial design is recommended, where n is the number of variables and k is the fraction of the full factorial design .

  • Key variables to consider:

    • Medium composition (yeast extract, tryptone, salts)

    • Carbon sources (glucose, glycerol concentrations)

    • Induction conditions (inducer concentration, cell density at induction)

    • Post-induction parameters (temperature, duration)

    • Antibiotic concentrations for plasmid maintenance

  • Central point replicates: Include at least three replicates at the central point of the design to estimate experimental error and check for curvature in the response .

  • Analysis methods: Use ANOVA to determine statistically significant factors and interactions, followed by response surface methodology to optimize conditions if needed.

This multivariant approach allows researchers to characterize experimental error, compare the effects of variables relative to each other, and gather high-quality information with fewer experiments than traditional approaches .

What are the most reliable assays for measuring UbiB activity in experimental systems?

Given UbiB's complex role in ubiquinone biosynthesis, multiple complementary assays should be employed:

Table 2: Recommended Assays for UbiB Functional Analysis

Assay TypeMethodologyMeasurable ParametersLimitations
Ubiquinone quantificationHPLC-UV/MSTotal CoQ contentEndpoint measurement only
Metabolite profilingLC-MS/MSAccumulated intermediatesRequires specialized equipment
Complementation assaysExpression in ubiB mutantsRestoration of ubiquinone productionNot a direct measure of activity
Oxygen consumptionClark electrodeRate of reaction in membrane preparationsMultiple factors affect results
Protein phosphorylationIn vitro kinase assaysSubstrate specificity, kineticsRequires identified substrates
ATP binding/hydrolysisIsothermal titration calorimetryBinding constants, catalytic ratesPurified protein required

For kinase activity specifically, researchers should develop phosphorylation assays using potential protein substrates involved in the monooxygenase steps of ubiquinone biosynthesis. Since the natural substrates remain unknown, a proteomics approach to identify differentially phosphorylated proteins in wild-type versus ubiB mutant strains may be necessary to identify candidate substrates for in vitro assays .

How can researchers distinguish between direct and indirect effects when characterizing UbiB mutants?

Distinguishing direct from indirect effects is a critical challenge when characterizing UbiB mutants, especially given its potential regulatory role. The following approaches are recommended:

  • Complementation analysis: Test whether wild-type UbiB expressed in trans can restore normal phenotype. Then use site-directed mutants in key domains to determine which functions are essential.

  • Temporal resolution: Use inducible expression systems to follow the sequence of events after UbiB induction, with early events more likely to represent direct effects.

  • Biochemical reconstitution: Develop in vitro systems with purified components to test direct interactions and activities.

  • Epistasis analysis: Create double mutants with other ubiquinone biosynthesis genes to establish genetic relationships and pathway organization.

  • Suppressor screening: Identify suppressors of ubiB mutations to reveal functional connections and bypass mechanisms.

  • Structural biology: Determine UbiB's three-dimensional structure and use this to predict functional domains and potential interaction surfaces.

This multifaceted approach can help distinguish between direct catalytic functions of UbiB and its potential indirect effects through regulatory mechanisms such as protein phosphorylation.

What strategies can overcome solubility issues when expressing recombinant UbiB for structural studies?

UbiB, like many membrane-associated proteins involved in ubiquinone biosynthesis, presents challenges for recombinant expression in soluble form. The following strategies are recommended:

  • Fusion tags: N-terminal solubility-enhancing tags such as MBP (maltose-binding protein), SUMO, or Thioredoxin can significantly improve solubility while allowing later removal by specific proteases.

  • Expression temperature optimization: As shown in experimental design studies, lower temperatures (25°C or below) can dramatically improve soluble protein yield by slowing folding kinetics and preventing aggregation .

  • Co-expression with chaperones: Co-expressing UbiB with chaperone systems like GroEL/ES, DnaK/J-GrpE, or trigger factor can facilitate proper folding.

  • Domain engineering: Expressing individual domains or creating truncated versions may improve solubility while maintaining critical functional regions.

  • Solubilizing agents: Addition of mild detergents or lipid nanodiscs during purification can help maintain solubility of membrane-associated domains.

  • Directed evolution: Creating libraries of UbiB variants and screening for improved solubility while maintaining function.

These approaches should be tested systematically, preferably using multivariant experimental design to efficiently identify optimal conditions .

How can researchers address potential issues with UbiB stability during purification and functional studies?

UbiB stability is critical for successful purification and functional characterization. The following approaches can enhance protein stability:

  • Buffer optimization: Systematic screening of buffer components including:

    • pH range (typically 6.5-8.0)

    • Salt type and concentration (150-500 mM NaCl)

    • Stabilizing additives (glycerol 5-20%, reducing agents such as DTT or TCEP)

  • Thermal shift assays: Use differential scanning fluorimetry to rapidly identify buffer conditions that maximize thermal stability.

  • Limited proteolysis: Identify stable domains resistant to proteolysis that may be more amenable to structural and functional studies.

  • Co-purification with binding partners: If UbiB functions in a complex, co-expression and co-purification with interaction partners may enhance stability.

  • Surface engineering: Modifying surface residues through site-directed mutagenesis to reduce aggregation propensity without affecting core function.

Stability during functional assays can be monitored by including controls for activity over time under the assay conditions, and by minimizing freeze-thaw cycles of protein preparations.

What are the most promising approaches for elucidating the complete mechanism of UbiB in ubiquinone biosynthesis?

The current understanding of UbiB suggests it may function as a regulatory kinase rather than directly as a monooxygenase in ubiquinone biosynthesis . The most promising approaches to fully elucidate its mechanism include:

  • Structural biology: Determining the high-resolution structure of UbiB, ideally in complex with nucleotides and potential substrates, would provide critical insights into its biochemical function.

  • Identification of phosphorylation targets: Phosphoproteomic approaches comparing wild-type and ubiB mutant strains could reveal proteins whose phosphorylation state depends on UbiB, potentially identifying direct substrates.

  • Reconstitution of ubiquinone biosynthesis: Developing an in vitro system with purified components that can convert early precursors to ubiquinone would allow systematic testing of UbiB's role.

  • Real-time monitoring of ubiquinone biosynthesis: Developing assays that can follow the conversion of intermediates in real-time would help establish the temporal sequence of reactions and regulatory events.

  • Comparative genomics and evolutionary analysis: Comprehensive analysis of UbiB homologs across diverse organisms may reveal conserved features essential to its function and identify species-specific adaptations.

These approaches, particularly when combined, have the potential to resolve the current questions surrounding UbiB's precise role in ubiquinone biosynthesis.

How might systems biology approaches enhance our understanding of UbiB's role in cellular metabolism?

UbiB's function extends beyond its immediate role in ubiquinone biosynthesis to potentially impact broader cellular metabolism. Systems biology approaches that could provide integrated understanding include:

  • Metabolic flux analysis: Using isotope-labeled precursors to trace carbon flow through central metabolism and ubiquinone biosynthesis in wild-type and ubiB mutant strains.

  • Global transcriptomics and proteomics: Comparing gene expression and protein abundance profiles between wild-type and ubiB mutant strains under various growth conditions.

  • Protein-protein interaction networks: Using techniques like proximity labeling (BioID or APEX) to map the interaction network of UbiB under different conditions.

  • Computational modeling: Developing kinetic models of ubiquinone biosynthesis that incorporate regulatory mechanisms to predict system behavior under various perturbations.

  • Integration with stress responses: Investigating how UbiB activity responds to and influences cellular responses to oxidative stress, changes in electron transport chain activity, and other metabolic challenges.

These systems-level approaches could reveal how UbiB functions as part of a larger regulatory network controlling ubiquinone biosynthesis in response to cellular energy needs and environmental conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.