Recombinant Escherichia coli O17:K52:H18 Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Introduction

Lgt is a 291-amino acid inner membrane protein encoded by the lgt gene in Escherichia coli. It modifies prolipoproteins by attaching a diacylglyceryl moiety to a conserved cysteine residue within the lipobox motif ([LVI][ASTVI][GAS]C), enabling subsequent steps in lipoprotein maturation . Recombinant Lgt from the uropathogenic E. coli O17:K52:H18 strain (UniProt ID: B7N760) is utilized in biochemical assays and structural studies to elucidate its mechanism and explore therapeutic targeting .

Enzymatic Mechanism

Lgt catalyzes the transfer of an sn-1,2-diacylglyceryl group from PG to prolipoproteins via a three-step process:

  1. Recognition of the lipobox motif in nascent prolipoproteins.

  2. Extraction of the diacylglyceryl moiety from PG.

  3. Covalent attachment to the cysteine thiol group, releasing glycerolphosphate .
    In vitro assays using recombinant Lgt confirmed activity even in the absence of excess PG, suggesting pre-bound substrate in the enzyme’s active site .

Functional Insights from Depletion Studies

  • Essentiality: lgt deletion in E. coli is lethal, causing outer membrane permeabilization and increased antibiotic sensitivity .

  • Morphological effects: Depletion leads to cell enlargement and inner membrane contraction due to osmotic stress .

  • Virulence attenuation: Partial Lgt inhibition reduces bacterial survival in murine infection models .

Therapeutic Potential and Inhibitor Development

Lgt is a validated antibiotic target due to its essential role and conserved mechanism. Key inhibitors include:

InhibitorIC50 (μM)Bactericidal ActivityTarget Pathogens
G28240.18YesE. coli, A. baumannii
G90660.24Not reportedE. coli

These compounds disrupt PG binding and diacylglyceryl transfer, leading to cell death . Unlike downstream lipoprotein pathway inhibitors, Lgt-targeting drugs remain effective even in lpp-deficient strains, circumventing a common resistance mechanism .

Biotechnological Applications

Recombinant Lgt enables:

  • Antibiotic-free plasmid selection: lgt complementation systems enhance plasmid stability in protein production .

  • Structural biology: Crystal structures guide rational drug design .

  • Enzyme kinetics studies: Fluorescent assays (e.g., lipoGFP-based systems) quantify transferase activity .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributor.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice packaging is required, please notify us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference point.
Shelf Life
Shelf life is influenced by multiple factors including storage conditions, buffer components, temperature, and inherent protein stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
lgt; ECUMN_3155; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Target Names
lgt
Target Protein Sequence
MTSSYLHFPEFDPVIFSIGPVALHWYGLMYLVGFIFAMWLATRRANRPGSGWTKNEVENL LYAGFLGVFLGGRIGYVLFYNFPQFMADPLYLFRVWDGGMSFHGGLIGVIVVMIIFARRT KRSFFQVSDFIAPLIPFGLGAGRLGNFINGELWGRVDPNFPFAMLFPGSRTEDILLLQTN PQWQSIFDTYGVLPRHPSQLYELLLEGVVLFIILNLYIRKPRPMGAVSGLFLIGYGAFRI IVEFFRQPDAQFTGAWVQYISMGQILSIPMIVAGVIMMVWAYRRSPQQHVS
Uniprot No.

Target Background

Function
Prolipoprotein diacylglyceryl transferase (Lgt) is an enzyme that catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the maturation of lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biochemical function of Lgt in E. coli?

Lgt catalyzes the transfer of diacylglyceryl from phosphatidylglycerol to a peptide substrate via formation of a thioether bond. This reaction represents the first step in the biogenesis of bacterial lipoproteins, which are critical components of the bacterial cell envelope. Specifically, Lgt targets the conserved cysteine residue in lipoprotein signal sequences, as demonstrated in studies with the Pal lipoprotein where the peptide substrate (Pal-IAAC) contains this critical cysteine residue . The reaction produces glycerol phosphate as a byproduct, with both glycerol-1-phosphate (G1P) and glycerol-3-phosphate (G3P) released when using racemic glycerol-containing phosphatidylglycerol substrates in biochemical assays . This diacylglyceryl modification is essential for proper lipoprotein anchoring in the bacterial membrane system.

Why is Lgt considered essential in Gram-negative bacteria?

Lgt is essential because its depletion leads to lethal consequences for Gram-negative bacteria such as E. coli. Research demonstrates that genetic depletion of Lgt is lethal in vitro, and growth can only be rescued through complementation with a functional copy of the lgt gene . The essentiality stems from Lgt's role in the proper biogenesis of lipoproteins, which maintain outer membrane integrity. When Lgt is depleted, researchers observe permeabilization of the outer membrane, increased sensitivity to serum killing, and enhanced susceptibility to antibiotics . Additionally, Lgt depletion disrupts the phosphatidylglycerol association of lipoproteins like Lpp and Pal, which further compromises membrane integrity . This essentiality makes Lgt an attractive target for antimicrobial development.

How can Lgt activity be measured in laboratory settings?

Lgt enzymatic activity can be measured through a biochemical assay that detects the release of glycerol phosphate, a byproduct of the Lgt-catalyzed transfer of diacylglyceryl. The standard methodology involves:

  • Using a peptide substrate derived from a lipoprotein (e.g., Pal-IAAC, where C is the conserved cysteine modified by Lgt)

  • Incubating with phosphatidylglycerol substrate and purified Lgt enzyme

  • Measuring released glycerol phosphate through a coupled luciferase reaction

Researchers have successfully used this approach to evaluate Lgt inhibitors, demonstrating IC₅₀ values of 0.24 μM, 0.93 μM, and 0.18 μM for compounds G9066, G2823, and G2824, respectively . For controls, researchers typically use a mutant peptide substrate with the conserved cysteine mutated to alanine (Pal-IAA) to confirm reaction specificity. This assay provides a reliable quantitative measure of Lgt activity that can be used for both basic research and drug discovery efforts.

What methodologies are effective for generating and validating Lgt inhibitors?

The development and validation of Lgt inhibitors requires a multi-faceted approach combining biochemical and genetic strategies. The research presented in the search results outlines an effective methodology:

  • Initial screening: Affinity selection of macrocyclic peptides binding to biotinylated E. coli Lgt in 0.02% n-dodecyl β-D-maltoside (DDM) detergent can identify potential binders . This involves:

    • Using an mRNA-peptide fusion library generated through in vitro translation

    • Incubation with biotinylated Lgt target protein

    • Isolation of binders using streptavidin-coated beads

    • Sequencing of enriched cDNA to identify hit compounds

  • Biochemical validation: Testing inhibitory activity through the glycerol phosphate release assay to determine IC₅₀ values for hit compounds .

  • Target validation in cells:

    • Utilization of CRISPRi technology to decrease gene expression of Lgt and related enzymes

    • Demonstration of specific sensitization to Lgt inhibitors when Lgt expression is reduced

    • Comparison with inhibitors of other lipoprotein biosynthesis enzymes (e.g., LspA and LolCDE) to confirm specificity

  • Phenotypic confirmation: Verification that Lgt inhibitors recapitulate the phenotypes observed with genetic depletion of Lgt, including outer membrane blebbing, increased cell size, and disruption of lipoprotein processing patterns in pulse-chase experiments .

This comprehensive validation approach ensures that any identified Lgt inhibitors are truly acting on-target and provides a framework for future drug discovery efforts targeting this essential enzyme.

How does deletion of lpp affect resistance to Lgt inhibition, and what does this reveal about resistance mechanisms?

One of the most significant findings regarding Lgt inhibition is that, unlike with inhibitors targeting downstream steps in the lipoprotein biosynthesis pathway, deletion of the major outer membrane lipoprotein gene lpp does not provide resistance to Lgt inhibitors or rescue growth after Lgt depletion . This observation has important implications for understanding resistance mechanisms:

  • Biochemical basis: When Lgt is inhibited, there is decreased phosphatidylglycerol (PG) association of lipoproteins like Lpp. Experiments demonstrate that cells expressing only Lpp with the conserved cysteine modified (Lpp C21A) show significantly reduced PG-linkage of Lpp . This indicates that inhibition of the diacylglyceryl modification by Lgt creates a less optimal substrate for the L,D-transpeptidases that covalently link Lpp to peptidoglycan.

  • Resistance comparison table:

Inhibition TargetEffect of lpp DeletionResistance Mechanism
LgtNo rescue of growthUnknown
LspA (signal peptidase II)Rescues growthPrevents accumulation of toxic lipoprotein intermediates
LolCDE (lipoprotein transport)Rescues growthPrevents accumulation of toxic lipoprotein intermediates
  • Implications for drug development: This discovery suggests that Lgt inhibitors may be less susceptible to one of the most common resistance mechanisms that invalidate inhibitors of downstream steps of bacterial lipoprotein biosynthesis and transport . The inability to raise on-target resistant mutants to Lgt inhibitors supports the hypothesis that mutations disrupting inhibitor binding might result in loss of Lgt function, which is itself lethal . This parallels observations with globomycin (an LspA inhibitor), where no on-target resistance mutations have ever been described.

This data reveals important insights into the unique properties of Lgt as an antimicrobial target and highlights potential advantages for drug development targeting this enzyme.

What are the challenges in overexpressing recombinant Lgt for structural and functional studies?

Overexpression and purification of recombinant Lgt present several significant challenges for researchers:

  • Membrane protein expression: As an integral membrane protein, Lgt is difficult to express at high levels without toxicity to the host cell. Standard expression systems often result in decreased bacterial fitness when Lgt is overexpressed . This balancing act between expression and toxicity requires careful optimization of induction conditions.

  • Selection and stability concerns: Traditional antibiotic-based selection for Lgt expression vectors can be problematic due to instability. The research presents a novel approach using an lgt-based selection system, where the chromosomal lgt gene is deleted and complemented by a plasmid-borne copy . This strategy confers extreme stability on expression plasmids without antibiotic selection.

  • Cross-species complementation: For functional studies, using heterologous Lgt from different bacterial species can be advantageous. The search results describe a system where E. coli lgt was deleted and complemented with Vibrio cholerae lgt (and vice versa) . This approach allows for the expression of functional Lgt while potentially reducing toxic effects on the host.

  • Purification challenges: Once expressed, Lgt requires detergent solubilization for activity and structural studies. The affinity selection experiments described used 0.02% n-dodecyl β-D-maltoside (DDM) , suggesting this as an appropriate detergent for maintaining Lgt in an active conformation during purification and subsequent assays.

These challenges necessitate specialized approaches for successful recombinant Lgt studies, particularly when high yields of functional protein are required for structural biology or biochemical characterization.

How can the Lgt gene be utilized as a selection marker for stable plasmid maintenance?

The lgt gene offers a novel, antibiotic-free selection system for stable plasmid maintenance in bacterial expression systems. The methodology involves:

  • Creating an lgt deletion strain: The chromosomal lgt gene is deleted from the bacterial genome (E. coli or other Gram-negative bacteria) and initially complemented with a temperature-sensitive plasmid carrying a functional lgt gene (e.g., from Vibrio cholerae) . This allows the cells to grow at permissive temperature (30°C) but not at restrictive temperature (37°C).

  • Expression vector construction: A temperature-insensitive expression vector carrying the complementing lgt gene is constructed. Transformants are selected simply by growth at the restrictive temperature (39°C) . Since lgt is essential, only cells that maintain the plasmid can survive.

  • Protein expression application: This system has been successfully used to express diverse recombinant proteins, including:

    • Soluble proteins

    • Proteins forming insoluble inclusion bodies

    • Secreted proteins like cholera toxin B subunit (CTB)

  • Cross-species application: The system can be transferred between Gram-negative species. As demonstrated, E. coli lgt can complement a V. cholerae lgt deletion and vice versa .

This methodology offers several advantages over traditional antibiotic selection:

  • Extreme stability of expression plasmids without antibiotics

  • Reduced spread of antibiotic resistance genes

  • Reduced release of antibiotics into the environment

  • Final products free from potentially harmful antibiotic residues

These features make the lgt-based selection system particularly valuable for applications in pharmaceutical protein production where antibiotic contamination is a concern.

What experimental approaches can validate on-target activity of potential Lgt inhibitors?

Validating that compounds are truly inhibiting Lgt rather than affecting other cellular processes requires a multi-pronged experimental approach:

  • Biochemical assay validation:

    • Direct measurement of Lgt enzymatic inhibition using the glycerol phosphate release assay

    • Determination of IC₅₀ values to quantify potency

    • Use of mutant peptide substrates (e.g., Pal-IAA) as negative controls

  • Genetic sensitization experiments:

    • CRISPRi-mediated downregulation of lgt expression to create sensitized strains

    • Demonstration that reduced lgt expression specifically sensitizes cells to Lgt inhibitors but not to inhibitors of other pathway components

    • Include appropriate controls such as downregulation of other pathway genes (lspA, lolC) and non-related genes (folA)

  • Phenotypic confirmation:

    • Microscopic examination for characteristic outer membrane blebbing and increased cell size

    • Comparison of phenotypes between Lgt inhibitor-treated cells and genetic lgt depletion

    • Analysis of lipoprotein processing patterns through pulse-chase experiments

  • Resistance studies:

    • Attempts to generate resistant mutants to confirm target (noting that the essential nature of Lgt may prevent on-target resistance)

    • Confirmation that LolCDEi-resistant mutants are not cross-resistant to Lgt inhibitors

    • Evaluation of whether lpp deletion affects sensitivity to Lgt inhibitors

A comprehensive table summarizing the experimental approaches:

Validation ApproachMethodologyExpected Outcome for On-Target Inhibition
Biochemical AssayGlycerol phosphate release assayDose-dependent inhibition of enzyme activity
Genetic SensitizationCRISPRi downregulation of lgtIncreased sensitivity specifically to Lgt inhibitors
Phenotypic AnalysisMicroscopy, protein analysisRecapitulation of lgt depletion phenotypes
Resistance StudiesSelection of resistant mutantsInability to generate on-target resistant mutants

These complementary approaches collectively provide strong evidence for on-target activity of potential Lgt inhibitors.

What are the optimal methods for analyzing lipoprotein processing upon Lgt inhibition or depletion?

Analysis of lipoprotein processing is crucial for understanding the effects of Lgt inhibition. The research presents several methodological approaches:

  • Pulse-chase experiments with radioactive labeling:

    • Pulse-labeling of newly synthesized proteins with radioactive amino acids

    • Chase with non-radioactive medium to follow protein processing over time

    • Immunoprecipitation of specific lipoproteins (e.g., Lpp, Pal)

    • Separation by SDS-PAGE to visualize processing intermediates

  • Peptidoglycan (PG) association analysis:

    • Isolation of peptidoglycan-associated proteins (PAP fractions)

    • Analysis of PG-linked forms of lipoproteins by SDS-PAGE

    • Identification of specific processing intermediates based on molecular weight shifts

    • Comparison between wild-type, Lgt-depleted, and inhibitor-treated cells

  • Lipoprotein form identification:

    • DGPLP: diacylglyceryl-modified prolipoprotein

    • UPLP: unmodified prolipoprotein

    • Detection of additional forms such as potential Lpp dimers (~14 kDa)

  • Mutant lipoprotein analysis:

    • Engineering cells to express mutant lipoproteins (e.g., Lpp C21A)

    • Analysis of PG association of these mutant forms

    • Provides insights into the relationship between Lgt modification and subsequent processing steps

These methods have revealed important insights into Lgt function, including:

  • Lgt depletion leads to a significant loss of DGPLP and other PG-linked Lpp forms

  • Modest accumulation of UPLP occurs in the PAP fractions

  • Lgt inhibition results in decreased PG-association of Lpp and Pal

  • The accumulated UPLP after Lgt inhibition either is not significantly linked to PG or does not accumulate to levels needed to induce cell death

These analytical approaches provide a comprehensive toolkit for researchers studying lipoprotein processing and the effects of targeting different steps in this pathway.

What are the potential applications of Lgt as a novel antibacterial target?

Lgt represents a promising antibacterial target with several potential applications and advantages:

  • Broad-spectrum activity: Lgt inhibitors have demonstrated bactericidal activity against different Gram-negative bacteria, including wild-type Acinetobacter baumannii and E. coli strains . The essential nature of Lgt across Gram-negative bacteria suggests potential broad-spectrum applications.

  • Unique resistance profile: Unlike inhibitors of other steps in lipoprotein biosynthesis, Lgt inhibitors are not affected by deletion of the major outer membrane lipoprotein lpp, which is one of the most common resistance mechanisms against inhibitors of downstream lipoprotein processing steps . This suggests a potentially higher barrier to resistance development.

  • Synergistic potential: Lgt depletion leads to permeabilization of the outer membrane and increased sensitivity to serum killing and antibiotics . This suggests that Lgt inhibitors may have synergistic effects when combined with existing antibiotics, potentially revitalizing compounds that have lost effectiveness due to permeability barriers.

  • Applications beyond antibiotic development:

    • Use in antibiotic-free selection systems for recombinant protein production

    • Tools for studying bacterial physiology and membrane biogenesis

    • Potential applications in attenuating bacterial virulence

  • Challenges to address:

    • Development of compounds with appropriate pharmacokinetic properties to reach Gram-negative target sites

    • Optimization of selectivity to avoid potential effects on human pathways

    • Scale-up of production for promising inhibitor compounds

The research into Lgt as an antibacterial target is still in its early stages, with the first inhibitors only recently identified. Further work on structure-based drug design, medicinal chemistry optimization, and in vivo efficacy studies will be needed to fully realize the potential of this promising target.

How might structure-based drug design approaches be applied to developing improved Lgt inhibitors?

  • Target site identification: Recent publications have revealed significant insights into the potential mechanisms of diacylglyceryl modification by Lgt . Understanding whether Lgt inhibitors competitively inhibit binding of the phosphatidylglycerol or prolipoprotein substrates would be critical for structure-based optimization.

  • Homology modeling: If the complete structure is unavailable, homology models could be constructed based on related proteins to predict the binding site architecture. This approach could guide the design of compounds that better fit the putative active site.

  • Fragment-based screening: Using fragments to identify binding hotspots within the Lgt active site could inform the design of more potent inhibitors. The reported macrocyclic peptide inhibitors (G2823, G2824) identified by affinity selection could serve as starting points .

  • Binding site conservation analysis: Since Lgt is highly conserved across Gram-negative bacteria, analysis of conserved regions likely to be involved in substrate binding could inform inhibitor design. It's hypothesized that Lgt inhibitors might bind to the conserved phosphatidylglycerol binding site .

  • Structure-activity relationship studies: Systematic modification of the identified inhibitor scaffolds coupled with biochemical assays could reveal key structural features required for activity, even in the absence of a crystal structure.

A particular challenge in this approach is that mutations disrupting inhibitor binding might result in loss of Lgt function, leading to cell death . This parallels observations with globomycin (an LspA inhibitor), where no on-target resistance mutations have been described, suggesting binding to a highly conserved active site . This characteristic makes Lgt an attractive but challenging target for structure-based design.

What cross-species differences in Lgt function and inhibition need to be considered in research applications?

Understanding cross-species differences in Lgt function and inhibition is critical for both basic research and drug development applications. Several important considerations emerge:

  • Functional conservation and complementation:

    • The search results demonstrate that Lgt from different species can functionally complement each other. For example, Vibrio cholerae lgt can complement an E. coli lgt deletion and vice versa .

    • This functional conservation suggests structural similarities in the active site across species, which is promising for broad-spectrum inhibitor development.

  • Expression and regulation differences:

    • Different bacterial species may have different expression levels and regulation of lgt, which could impact the effectiveness of gene-based selection systems.

    • When using lgt from one species in another, expression levels need to be optimized to ensure sufficient function without toxicity.

  • Substrate specificity considerations:

    • While the core function of Lgt is conserved, subtle differences in substrate preference may exist between species.

    • For inhibitor development, these differences could impact spectrum of activity and potency against different pathogens.

  • Species-specific physiological consequences:

    • The impact of Lgt inhibition may vary between species based on differences in membrane architecture and the specific roles of lipoproteins in each organism.

    • For example, the essentiality of Lgt has been demonstrated in E. coli and other Gram-negative organisms , but the specific physiological consequences may differ.

  • Experimental design implications:

    • When designing Lgt-based selection systems, researchers should consider species compatibility. The search results describe successful use of E. coli-derived lgt gene for complementation in other Gram-negative species .

    • For biochemical assays, purified Lgt from the species of interest should ideally be used, though the high conservation suggests assays might be transferable.

These cross-species considerations highlight both the opportunities and challenges in Lgt research, particularly for applications seeking broad-spectrum activity or transferability between different bacterial systems.

What are common technical challenges in establishing lgt-based selection systems?

Establishing lgt-based selection systems presents several technical challenges that researchers should anticipate and address:

  • Creating viable lgt deletion strains:

    • Since lgt is essential, a complementation strategy must be in place before deletion of the chromosomal gene.

    • The search results describe using a temperature-sensitive plasmid carrying a functional lgt gene, allowing growth at permissive temperature (30°C) but not at restrictive temperature (37°C) .

    • Careful optimization of growth conditions during strain construction is critical.

  • Downstream gene expression effects:

    • The thyA gene (encoding thymidylate synthase) is downstream of lgt and its ribosome binding site overlaps with the lgt stop codon in E. coli.

    • When manipulating lgt, researchers must confirm that thyA expression remains unchanged to avoid confounding effects .

    • This can be verified through expression analysis as demonstrated in the research.

  • Balancing expression levels:

    • Too little expression of the complementing lgt gene will fail to support growth, while too much may be toxic.

    • Careful selection of promoters and ribosome binding sites with appropriate strength is necessary.

    • The search results describe successful use of both E. coli and V. cholerae lgt genes for complementation .

  • Temperature considerations:

    • The lgt-based selection system described relies on temperature shifts (growth at 39°C to select transformants) .

    • Some recombinant proteins may be temperature-sensitive, requiring adaptation of the system.

    • Compatibility with the expression conditions for the target protein must be considered.

  • Strain background effects:

    • Different E. coli strains may respond differently to lgt manipulation.

    • The search results mention successful implementation in both laboratory and clinical isolate strains .

    • Researchers should validate the system in their specific strain background.

By anticipating these challenges, researchers can more effectively implement lgt-based selection systems for stable plasmid maintenance without antibiotics, contributing to safer recombinant protein production for pharmaceutical applications.

How can researchers optimize biochemical assays for screening Lgt inhibitors?

Optimizing biochemical assays for screening Lgt inhibitors requires careful consideration of several factors to ensure reliability, sensitivity, and reproducibility:

  • Enzyme preparation and stability:

    • Lgt is a membrane protein requiring detergent solubilization

    • The search results indicate successful use of 0.02% n-dodecyl β-D-maltoside (DDM) for maintaining Lgt activity

    • Proper storage conditions to maintain enzyme stability between assays are critical

  • Substrate selection and concentration:

    • Peptide substrate derived from the Pal lipoprotein (Pal-IAAC) has been successfully used

    • Phosphatidylglycerol substrate concentration should be optimized for signal-to-noise ratio

    • Control substrates (e.g., Pal-IAA with cysteine mutated to alanine) should be included

  • Detection method optimization:

    • The coupled luciferase reaction for detecting glycerol phosphate release should be calibrated

    • The assay described measures both G1P and G3P released from racemic phosphatidylglycerol

    • Standard curves should be established for accurate quantification

  • Assay parameters:

    • Buffer composition, pH, salt concentration, and metal ion requirements should be optimized

    • Reaction time and temperature need calibration for linear response range

    • DMSO tolerance should be established for compound screening

  • Data analysis and quality control:

    • Z' factor determination to assess assay quality

    • Inclusion of positive controls (known inhibitors like G9066, G2823, or G2824)

    • Statistical methods for hit identification and IC₅₀ determination

A recommended assay workflow based on the search results:

StepDescriptionKey Considerations
1Enzyme preparationUse biotinylated E. coli Lgt in 0.02% DDM
2Substrate preparationPal-IAAC peptide and phosphatidylglycerol
3Inhibitor pre-incubationAllow sufficient time for binding
4Reaction initiationAdd substrates and monitor glycerol phosphate release
5DetectionCouple to luciferase reaction for luminescence readout
6Data analysisCalculate percent inhibition and IC₅₀ values

This optimized biochemical assay provides a foundation for high-throughput screening campaigns to identify novel Lgt inhibitors with potential as antibacterial agents.

What controls are essential when evaluating phenotypes associated with Lgt inhibition?

When evaluating phenotypes associated with Lgt inhibition, proper controls are essential for distinguishing on-target effects from non-specific toxicity or off-target activities. Based on the search results, the following controls are recommended:

  • Genetic depletion controls:

    • Engineered strains with inducible lgt deletion (e.g., CFT073 Δlgt under arabinose control)

    • Complementation with functional lgt to demonstrate phenotype rescue

    • These genetic controls establish the expected phenotypes for on-target Lgt inhibition

  • Compound specificity controls:

    • Treatment with inhibitors of other lipoprotein biosynthesis enzymes (e.g., LspAi, LolCDEi)

    • Comparison of phenotypes between different inhibitor classes

    • This approach distinguishes Lgt-specific effects from general effects of disrupting lipoprotein processing

  • Genetic sensitization controls:

    • CRISPRi-mediated downregulation of lgt expression

    • Parallel downregulation of related genes (lspA, lolC) and unrelated genes (folA)

    • Demonstration of specific sensitization to Lgt inhibitors when lgt expression is reduced

  • Lipoprotein processing controls:

    • Analysis of processing patterns of multiple lipoproteins (e.g., Lpp, Pal)

    • Comparison with defined mutants (e.g., Lpp C21A) that cannot be modified by Lgt

    • These controls confirm the biochemical consequences of Lgt inhibition

  • Concentration-dependent effects:

    • Treatment with a range of inhibitor concentrations

    • Correlation of phenotypic effects with biochemical inhibition potency

    • This approach helps distinguish specific effects at relevant concentrations from non-specific effects at high concentrations

A comprehensive phenotypic analysis should include:

PhenotypeMethodologyPositive ControlNegative Control
Growth inhibitionGrowth curvesLgt depletion strainScrambled gRNA strain
Membrane permeabilityDye uptake assaysLgt depletion strainWild-type with vehicle
OM blebbingMicroscopyLgt depletion strainPal-deficient strain
Lipoprotein processingPAP fraction analysisLspA inhibitionVehicle treatment
Serum/antibiotic sensitivitySurvival assaysLgt depletion strainWild-type with vehicle

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.