Recombinant Escherichia coli O17:K52:H18 Spermidine export protein MdtI (mdtI)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested. Advance notice and additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please specify this in your order for preferential development.
Synonyms
mdtI; ECUMN_1884; Spermidine export protein MdtI
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-109
Protein Length
full length protein
Species
Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Target Names
mdtI
Target Protein Sequence
MAQFEWVHAAWLALAIVLEIVANVFLKFSDGFRRKIFGLLSLAAVLAAFSALSQAVKGID LSVAYALWGGFGIAATLAAGWILFGQRLNRKGWIGLVLLLAGMIMVKLA
Uniprot No.

Target Background

Function
Catalyzes spermidine excretion.
Database Links
Protein Families
Small multidrug resistance (SMR) protein family, MdtI subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of MdtI protein in Escherichia coli?

MdtI functions as a critical component of the spermidine excretion system in E. coli. Research has demonstrated that MdtI works in conjunction with MdtJ to form the MdtJI complex, which catalyzes the export of spermidine from bacterial cells at neutral pH . This heterodimeric complex belongs to the small multidrug resistance (SMR) family of transporters.

The significance of this protein became apparent when researchers screened 33 putative drug exporters in E. coli and identified MdtJI as the only complex capable of significantly enhancing cell viability in the presence of high spermidine concentrations . While some SMR family proteins were previously known to export negatively charged substances, the MdtJI complex represents the first identified SMR transporter that exports a positively charged substance like spermidine .

MdtI contains 109 amino acids and is predicted to have four transmembrane segments, consistent with the typical structure of SMR family proteins . The protein plays a crucial role in maintaining polyamine homeostasis, which is essential for normal bacterial growth and survival under various environmental conditions.

How does the MdtJI complex protect E. coli from spermidine toxicity?

The MdtJI complex provides protection against spermidine toxicity through an active export mechanism that prevents the intracellular accumulation of toxic levels of spermidine. Research using a spermidine acetyltransferase-deficient strain (E. coli CAG2242), which lacks the primary metabolic pathway for detoxifying spermidine, demonstrated that expression of the MdtJI complex dramatically enhanced cell viability in the presence of high spermidine concentrations .

Quantitative experimental data reveals the protective effect:

StrainConditionCell Viability (%)
CAG2242/pUC119 (control)Without spermidine100
CAG2242/pUC119 (control)With 2 mM spermidine<0.1
CAG2242/pUC mdtJIWith 2 mM spermidine>100 (>1000-fold increase)

Measurements of intracellular spermidine levels further confirm this protective mechanism:

StrainTime of incubation (h)Addition of 2 mM spermidineSpermidine concentration (mM)
CAG2242/pUC11924-5.73 ± 1.04
CAG2242/pUC11924+30.9 ± 2.28
CAG2242/pUC mdtJI24-4.71 ± 1.06
CAG2242/pUC mdtJI24+12.1 ± 2.06

These results demonstrate that the MdtJI complex significantly reduces intracellular spermidine accumulation, thereby mitigating its toxic effects . This export mechanism represents a third distinct pathway for managing polyamine toxicity in bacteria, complementing the previously known mechanisms of spermidine acetylation and neutralization by L-glycerol 3-phosphate.

What is the relationship between MdtI and MdtJ proteins in the functional complex?

MdtI and MdtJ are functionally interdependent proteins that form a heterodimeric complex necessary for spermidine export. Research has demonstrated that neither protein functions effectively in isolation - both components are required for spermidine export activity .

The genes mdtI (also known as ydgE) and mdtJ (also known as ydgF) are co-expressed as part of an operon. When either mdtI or mdtJ was transformed alone into E. coli CAG2242 (spermidine acetyltransferase-deficient), cell viability in the presence of spermidine did not increase significantly. Only when both proteins were expressed together was there a substantial increase in cell viability .

From a structural perspective, both MdtI and MdtJ belong to the SMR family of transporters and are predicted to have four transmembrane segments each. Based on structural studies of related SMR proteins like EmrE, they likely form a parallel dimer arrangement . In this configuration, specific amino acid residues from both proteins (Glu5, Glu19, Asp60, Trp68, and Trp81 in MdtI; Tyr4, Trp5, Glu15, Tyr45, Tyr61, and Glu82 in MdtJ) create a functional substrate binding site and translocation pathway specifically adapted for spermidine transport .

The complementary nature of their interaction suggests that MdtI and MdtJ have evolved to function specifically as a heterodimeric unit, with each protein contributing distinct structural and functional elements necessary for effective spermidine export.

How is the expression of mdtJI regulated in response to environmental factors?

The expression of mdtJI in E. coli is regulated in response to spermidine levels, providing a feedback mechanism for controlling polyamine homeostasis. Research has demonstrated that the level of mdtJI mRNA increases upon exposure to spermidine .

Through dot blot analysis, researchers observed that when E. coli CAG2242 cells transformed with pUC mdtJI were cultured in the presence of 2 mM spermidine, the level of mdtJI mRNA increased approximately 1.5- to 2.0-fold during culture from 12 h to 36 h compared to cells grown without spermidine . When exposed to higher concentrations (12 mM) of spermidine, the induction was even more pronounced, particularly at early time points after exposure.

The temporal pattern of mdtJI expression correlated with cell growth patterns in the presence of spermidine, suggesting that this regulation is physiologically relevant for adapting to environments with high polyamine concentrations. This upregulation mechanism represents an adaptive response that enhances the cell's capacity to export excess spermidine when faced with potentially toxic levels .

The researchers hypothesized that this increase in mdtJI mRNA is likely due to enhanced transcription rather than mRNA stabilization, although the specific transcriptional regulators and promoter elements involved were not fully characterized in the study. This spermidine-responsive regulation represents a crucial homeostatic mechanism that allows E. coli to adjust its spermidine export capacity according to environmental challenges.

What experimental approaches have been used to characterize MdtI function?

Researchers have employed multiple complementary experimental approaches to characterize the function of MdtI in E. coli:

  • Genetic complementation studies: Transformation of spermidine acetyltransferase-deficient E. coli strains (CAG2242) with plasmids expressing MdtI and MdtJ (individually or together) demonstrated that both proteins are required for function .

  • Cell viability assays: Quantification of colony formation on agar plates showed >1000-fold increase in viability for cells expressing MdtJI when grown with 2 mM spermidine .

  • Polyamine content measurement: High-performance liquid chromatography was used to measure intracellular polyamine levels, confirming that MdtJI expression decreased intracellular spermidine accumulation .

  • Direct spermidine excretion assays: Cells preloaded with [14C]spermidine demonstrated significantly higher rates of spermidine excretion when expressing MdtJI compared to controls .

  • Site-directed mutagenesis: Key amino acid residues in MdtI were identified by systematically replacing them (Glu5→Gln, Glu19→Gln, Asp60→Asn, Trp68→Leu, and Trp81→Leu) and assessing the impact on function .

  • Expression analysis: Dot blot analysis measured mdtJI mRNA levels in response to spermidine, revealing upregulation in the presence of spermidine .

  • Western blot analysis: Protein expression levels were confirmed using epitope-tagged versions of the proteins (His-tagged MdtI and HA-tagged MdtJ) .

  • Growth inhibition studies: The protective effect of MdtJI was assessed by measuring cell growth in liquid culture with varying concentrations of spermidine .

These diverse experimental approaches collectively provided strong evidence for the role of MdtI in spermidine export and identified the key structural elements required for this function. The complementary nature of these methods established both the physiological relevance and the molecular mechanisms of MdtI function.

How do the structural features of MdtI contribute to its function in spermidine export?

The structural features of MdtI play a crucial role in its function as part of the spermidine export complex. While a complete high-resolution structure was not available in the referenced studies, several key structural elements have been identified through experimental approaches:

  • Transmembrane topology: MdtI, like other members of the SMR family, is predicted to have four transmembrane segments that span the cell membrane, creating a transport pathway for spermidine .

  • Functional amino acid residues: Mutagenesis studies identified five specific amino acid residues in MdtI that are essential for spermidine export activity:

    • Glu5

    • Glu19

    • Asp60

    • Trp68

    • Trp81

    When these residues were mutated, spermidine export activity was significantly reduced, as evidenced by decreased cell viability and increased intracellular spermidine accumulation .

  • Substrate recognition mechanism: The identified functional residues include both acidic (Glu, Asp) and aromatic (Trp) amino acids. This pattern suggests a specific mechanism for substrate recognition:

    • Acidic residues (Glu5, Glu19, Asp60) likely interact with the positively charged amine groups of spermidine through electrostatic interactions

    • Aromatic residues (Trp68, Trp81) probably interact with the hydrocarbon backbone of spermidine through hydrophobic interactions

  • Parallel dimer arrangement: Based on structural studies of related SMR proteins like EmrE, MdtI and MdtJ are thought to form a parallel dimer. In this arrangement, most of the functional amino acid residues would be located on the cytoplasmic side, facilitating spermidine capture from within the cell .

The specific combination of these structural features creates a specialized transport pathway that allows the MdtJI complex to specifically recognize and export spermidine, distinguishing it from other polyamines and cellular metabolites.

What are the key amino acid residues in MdtI essential for spermidine excretion and their functional roles?

Research has identified five specific amino acid residues in MdtI that are critical for spermidine export function . These were determined through site-directed mutagenesis experiments where individual amino acids were replaced, and the resulting impact on function was assessed:

Original ResiduePositionMutationEffect on Cell ViabilityEffect on Spermidine Content
Glu5Gln (E5Q)>100-fold decreaseIncreased to 30.9 ± 2.30 mM (from 11.7 ± 0.42 mM)
Glu19Gln (E19Q)>100-fold decreaseIncreased to 23.2 ± 1.35 mM
Asp60Asn (D60N)>100-fold decreaseIncreased to 20.9 ± 0.49 mM
Trp68Leu (W68L)>100-fold decreaseIncreased to 29.4 ± 2.14 mM
Trp81Leu (W81L)>100-fold decreaseIncreased to 20.7 ± 0.88 mM

Researchers confirmed that these mutations did not significantly affect protein expression levels, indicating that the observed functional defects were due to alterations in transport activity rather than reduced protein production .

The nature of these essential residues provides insight into the mechanism of spermidine recognition and transport:

  • The acidic residues (Glu5, Glu19, and Asp60) likely interact with the positively charged amine groups in spermidine through electrostatic interactions.

  • The aromatic tryptophan residues (Trp68 and Trp81) probably interact with the hydrophobic hydrocarbon backbone of spermidine.

This pattern of functional residues is consistent with the substrate binding mechanisms observed in other polyamine transport proteins, such as the spermidine-preferential uptake protein PotD, which also utilizes acidic and aromatic residues for substrate recognition . The presence of these specific residues creates a binding environment that is geometrically and electrostatically complementary to the spermidine molecule, enabling selective transport.

How does the MdtJI complex compare to other polyamine transport systems across bacterial species?

The MdtJI complex represents a distinct type of polyamine transport system with several unique characteristics when compared to other known bacterial polyamine transporters:

  • pH-dependent function:

    • MdtJI: Functions as a spermidine exporter at neutral pH

    • PotE (E. coli): Functions as a putrescine exporter at acidic pH but as a putrescine importer at neutral pH

    • CadB (E. coli): Functions as a cadaverine exporter at acidic pH but as a cadaverine importer at neutral pH

  • Structural family:

    • MdtJI: Belongs to the Small Multidrug Resistance (SMR) family

    • PotE and CadB: Belong to the Amino Acid-Polyamine-Organocation (APC) family

    • TPO1-5 (S. cerevisiae): Belong to the Major Facilitator Superfamily (MFS)

  • Transport mechanism:

    • MdtJI: Likely functions as an energy-dependent exporter, although the exact mechanism was not fully characterized

    • PotE: Functions as a putrescine-ornithine antiporter

    • CadB: Functions as a cadaverine-lysine antiporter

  • Polyamine specificity:

    • MdtJI: Specific for spermidine

    • PotE: Specific for putrescine

    • CadB: Specific for cadaverine

  • Physiological role:

    • MdtJI: Primary function appears to be detoxification of excess spermidine

    • PotE and CadB: Function in acid resistance through polyamine excretion and amino acid decarboxylation, which consumes protons and increases extracellular pH

The discovery of MdtJI as a neutral pH spermidine exporter filled a significant gap in understanding polyamine homeostasis in E. coli. Before this finding, no polyamine excretion proteins that function at neutral pH had been identified in this organism, despite the known importance of maintaining proper polyamine levels for cell growth and function .

What molecular mechanisms underlie spermidine recognition by the MdtJI complex?

The molecular mechanisms of spermidine recognition by the MdtJI complex involve specific interactions between key amino acid residues and the structural features of the spermidine molecule. Based on mutagenesis studies, a model for substrate recognition has emerged:

  • Electrostatic interactions with amine groups: The positively charged amine groups of spermidine are recognized by acidic amino acid residues in both MdtI and MdtJ:

    • In MdtI: Glu5, Glu19, and Asp60

    • In MdtJ: Glu15 and Glu82

  • Hydrophobic interactions with the carbon backbone: The propyl and butyl groups of spermidine interact with aromatic amino acid residues through hydrophobic interactions:

    • In MdtI: Trp68 and Trp81

    • In MdtJ: Tyr4, Trp5, Tyr45, and Tyr61

This recognition pattern is consistent with what has been observed for other polyamine binding proteins, such as PotD, which is part of the spermidine uptake system in E. coli .

The spatial arrangement of these residues within the transmembrane domains creates a binding pocket that specifically accommodates spermidine while excluding other similar molecules, providing the molecular basis for substrate selectivity in this transport system.

What are the recommended experimental approaches for studying the kinetics of spermidine export by MdtJI?

Several experimental approaches can be employed to study the kinetics of spermidine export by the MdtJI complex. Based on previous research and techniques commonly applied to membrane transporters, the following methodologies are recommended:

  • Radioactive substrate transport assays:

    • Preload cells with [14C]spermidine and measure its efflux over time

    • This approach was used by Higashi et al. (2007) and could be extended to determine kinetic parameters

    • Experimental protocol: Incubate cells (0.2 mg protein/ml) with 1 mM [14C]spermidine (37 MBq/mmol) for 90 min, wash, and measure radioactivity in the supernatant at various time points

  • Concentration-dependent transport studies:

    • Measure spermidine export rates at varying initial intracellular concentrations

    • Determine Km and Vmax values for the transport process

    • This would require preloading cells with different concentrations of spermidine

  • Competitive inhibition assays:

    • Test whether other polyamines or related compounds inhibit spermidine export

    • This could provide insights into substrate specificity and binding site characteristics

  • pH-dependent transport studies:

    • Measure spermidine export rates at different pH values

    • Determine the optimal pH for transport and assess how pH affects kinetic parameters

  • Membrane vesicle studies:

    • Prepare inside-out membrane vesicles containing the MdtJI complex

    • This approach would allow more precise control over substrate concentrations on both sides of the membrane

  • Reconstitution in proteoliposomes:

    • Purify the MdtJI complex and reconstitute it into artificial liposomes

    • This system would eliminate the influence of other cellular components and allow direct measurement of transport activity

  • Real-time fluorescence-based assays:

    • Use fluorescent spermidine analogs to monitor transport in real-time

    • This approach could provide insights into the dynamics of the transport process

  • Site-directed mutagenesis of conserved residues:

    • Generate mutations in residues predicted to be involved in energy coupling or conformational changes

    • Analyze how these mutations affect transport rates and substrate affinity

A comprehensive understanding of MdtJI kinetics would likely require a combination of several methods. The recombinant expression systems now available for E. coli O17:K52:H18 MdtI protein provide valuable tools for these investigations, as they allow the production of sufficient quantities of properly folded protein for detailed biochemical and biophysical studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.