Recombinant Escherichia coli O17:K52:H18 Universal stress protein B (uspB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes. We will then prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
uspB; ECUMN_3979; Universal stress protein B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Target Names
uspB
Target Protein Sequence
MISTVALFWALCVVCIVNMARYFSSLRALLVVLRNCDPLLYQYVDGGGFFTSHGQPNKQV RLVWYIYAQRYRDHHDDEFIRRCERVRRQFILTSALCGLVVVSLIALMIWH
Uniprot No.

Target Background

Database Links
Protein Families
Universal stress protein B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Universal stress protein B (uspB) and what is its role in Escherichia coli?

Universal stress protein B (uspB) belongs to the Universal stress protein (UspA) superfamily, a conserved group of proteins found in bacteria, archaea, and eukaryotes. In Escherichia coli, uspB is one of six usp genes (uspA, uspC, uspD, uspE, uspF, and uspG) that are triggered by various environmental stressors .

The UspA superfamily encompasses an ancient group of proteins present across all major branches of the evolutionary tree. Usp-containing organisms typically possess several usp genes despite their significant sequence similarity. These genes encode either small Usp proteins (~14-15 kDa) with one Usp domain, larger proteins (~30 kDa) with two tandem Usp domains, or large proteins where the Usp domain exists alongside other functional domains .

Specifically, uspB is involved in cellular reprogramming toward defense and escape during stress conditions. While UspC and UspE proteins promote motility at the expense of adhesion, UspF and UspG proteins demonstrate the opposite effects .

How can I distinguish between different Universal stress proteins in my experimental design?

Distinguishing between different Universal stress proteins requires a multi-faceted approach due to their structural and functional similarities:

  • Genetic characterization: Utilize PCR with gene-specific primers targeting the unique regions of each usp gene. This approach allows for differentiation based on genetic signatures.

  • Functional assays: Employ phenotypic characterization similar to the methods used by Nachin et al. , who performed deletion mutant studies to identify distinct functions:

    • Oxidative stress resistance assays: Test sensitivity to superoxide-generating agents like phenazine methosulfate (PMS) or peroxide agents like tert-butyl hydroperoxide (t-BOOH)

    • Motility assays: Assess bacterial swimming capacity on soft agar plates

    • Adhesion assays: Measure FimH-mediated agglutination of yeast cells

    • Iron metabolism assays: Evaluate sensitivity to streptonigrin, which indicates intracellular iron levels

  • Protein structure analysis: Based on amino acid sequence and structure analysis, E. coli Usp proteins can be categorized into four classes:

    • Class I: UspA, UspC, and UspD

    • Class II: UspF and UspG

    • Class III/IV: The two domains of UspE separate into these classes

This classification system provides a framework for distinguishing between structurally related proteins within your experimental design.

What experimental designs are most appropriate for studying uspB function?

When designing experiments to study uspB function, consider implementing rigorous experimental designs that account for potential confounding variables and allow for causal inferences. Based on established methodological principles , the following approaches are recommended:

Basic Experimental Designs:

  • Pre-experimental (AB) design: A simple approach where you measure the outcome before and after introducing uspB. While quick to implement, this design doesn't control for threats to internal validity and is only appropriate for preliminary explorations .

More Rigorous Designs:

  • Withdrawal designs (ABA/ABAB): These designs involve introducing and withdrawing uspB intervention to establish causality through pattern matching. They provide stronger experimental control when effects are immediate and large .

  • Multiple baseline design: Introduce uspB at different time points across different experimental units to demonstrate that changes in the dependent variable correspond with introduction of the independent variable .

Advanced Designs:

  • Factorial designs: Examine the interaction of uspB with other factors (e.g., other stress proteins, environmental conditions) by manipulating multiple independent variables simultaneously.

  • Single-subject experimental designs (SSEDs): These designs allow for detailed analysis of the effects of uspB in individual experimental units over time, which is particularly valuable for observing dynamic responses to stress conditions .

When implementing these designs, consider using visual analysis techniques to identify changes in level, trend, and variability in your dependent measures, as illustrated in Figure 1 of reference .

How should I prepare and store recombinant Escherichia coli O17:K52:H18 Universal stress protein B for optimal experimental results?

Proper preparation and storage of recombinant Escherichia coli O17:K52:H18 Universal stress protein B is critical for maintaining protein stability and experimental reproducibility. Based on established protocols , the following methodological approach is recommended:

Preparation:

  • Centrifugation: Briefly centrifuge the vial prior to opening to bring contents to the bottom .

  • Reconstitution: Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

  • Glycerol addition: Add 5-50% glycerol (final concentration) to stabilize the protein. A 50% final glycerol concentration is standard practice .

Storage conditions:

  • Temperature: Store at -20°C/-80°C for long-term storage. For working aliquots, store at 4°C for up to one week .

  • Aliquoting: Divide into small aliquots to avoid repeated freeze-thaw cycles, which can compromise protein integrity .

  • Shelf life: The shelf life is influenced by multiple factors including storage state, buffer ingredients, temperature, and protein stability. Generally:

    • Liquid form: 6 months at -20°C/-80°C

    • Lyophilized form: 12 months at -20°C/-80°C

Storage buffer composition:

  • Tris-based buffer with 50% glycerol, optimized for protein stability

Important considerations:

  • Avoid repeated freezing and thawing as this significantly reduces protein activity

  • For short-term applications (<1 week), working aliquots can be stored at 4°C

  • Protein purity should be >85% as determined by SDS-PAGE for reliable experimental results

How can I effectively assess the role of uspB in oxidative stress resistance compared to other Universal stress proteins?

To systematically evaluate the role of uspB in oxidative stress resistance in comparison to other Universal stress proteins, a comprehensive methodological approach is required:

1. Genetic manipulation techniques:

  • Generate single and multiple knockout mutants (ΔuspB, ΔuspA, ΔuspC, etc.) using targeted gene deletion methods

  • Create complementation strains to confirm phenotype specificity

  • Develop strains with controlled expression of uspB under inducible promoters

2. Stress exposure protocols:

  • Oxidative stress agents:

    • Superoxide-generating agents: Phenazine methosulfate (PMS)

    • Peroxide agents: Hydrogen peroxide (H₂O₂), tert-butyl hydroperoxide (t-BOOH)

  • Exposure conditions:

    • During exponential growth phase

    • During stationary phase

    • Under various nutrient limitations

3. Quantitative assessment methods:

  • Measure survival rates (colony-forming units) after oxidative stress exposure

  • Determine minimum inhibitory concentrations

  • Assess growth kinetics under stress conditions

  • Quantify specific stress biomarkers

4. Comparative analysis framework:
Based on research by Nachin et al. , a comparative analysis revealed distinct roles for different Usp proteins in oxidative stress resistance. While UspA and UspD exhibited significant protection against superoxide-generating agents, UspE showed specific protection against high concentrations of peroxide agents exclusively during stationary phase. This was attributable to UspE's role in cell-cell aggregation mediated by the Ag43 protein .

5. Data analysis approach:

  • Normalize survival data to wild-type controls

  • Apply appropriate statistical tests for group comparisons

  • Analyze synergistic or antagonistic effects in multiple mutants

  • Plot time-dependent survival curves under various stress conditions

Experimental insight from published research:
When analyzing the sensitivity of usp mutants to oxidative agent exposure during growth, class I proteins (UspA and UspD) showed major roles in PMS (superoxide) resistance. The contribution of UspD to PMS resistance may be associated with iron scavenging, as indicated by elevated sensitivity to streptonigrin. In contrast, the UspA mutant's PMS sensitivity was not linked to streptonigrin sensitivity, suggesting distinct mechanisms of action for these proteins .

What methodological approaches can be used to study the interaction between uspB and other cellular components during stress conditions?

To investigate the interactions between uspB and other cellular components during stress conditions, researchers should employ a comprehensive set of methodological approaches:

1. Protein-Protein Interaction Studies:

  • Co-immunoprecipitation (Co-IP): Use antibodies against uspB to pull down interacting proteins

  • Bacterial two-hybrid system: Identify direct protein interactions

  • Proximity-dependent biotin identification (BioID): Detect proteins in close proximity to uspB in live cells

  • Cross-linking mass spectrometry: Identify interaction interfaces between uspB and partner proteins

2. Transcriptomic and Proteomic Analysis:

  • RNA-Seq: Compare gene expression profiles between wild-type and uspB-deficient strains under stress conditions

  • Quantitative proteomics: Identify proteins with altered abundance or post-translational modifications in response to uspB activity

  • Ribosome profiling: Determine the impact of uspB on translation efficiency during stress

3. Genetic Interaction Mapping:

  • Synthetic genetic arrays: Identify genes that show synthetic lethality or suppression with uspB mutations

  • Transposon-sequencing (Tn-seq): Determine genes that become essential in uspB mutant backgrounds under stress

  • CRISPR interference screens: Identify genetic dependencies related to uspB function

4. Localization and Dynamics:

  • Fluorescence microscopy: Track uspB localization during stress responses using fluorescent protein fusions

  • Single-molecule tracking: Analyze dynamics of uspB movement within the cell

  • FRET-based sensors: Monitor conformational changes in uspB upon stress activation

5. Structural Biology Approaches:

  • X-ray crystallography or cryo-EM: Determine the structural basis of uspB interactions

  • Hydrogen-deuterium exchange mass spectrometry: Map regions involved in protein interactions

  • Nuclear magnetic resonance (NMR): Study dynamic interactions in solution

6. Systems Biology Integration:

  • Generate interaction networks integrating multiple data types

  • Model the dynamics of uspB-mediated stress responses

  • Predict and validate key nodes in the uspB interaction network

These methodological approaches provide complementary information that can be integrated to develop a comprehensive understanding of how uspB functions within cellular stress response networks. When designing such studies, it's important to consider appropriate controls and validation experiments to confirm the specificity and relevance of the identified interactions.

How can I address contradictions in experimental data related to Universal stress protein B function?

When confronting contradictory experimental data regarding Universal stress protein B function, a structured analytical approach is essential. Based on methodologies for handling data inconsistencies , I recommend the following framework:

1. Classify the type of contradiction pattern:
Apply the notation system proposed by researchers for contradiction patterns, using three parameters (α, β, θ) :

  • α: number of interdependent items

  • β: number of contradictory dependencies defined by domain experts

  • θ: minimal number of required Boolean rules to assess contradictions

For example, if contradictions involve two data items with one contradictory dependency requiring one Boolean rule, this would be classified as a (2,1,1) contradiction pattern .

2. Implement a systematic contradiction analysis workflow:

  • Identify potential sources of contradiction (methodological differences, biological variation, technical artifacts)

  • Assess the validity of contradictory findings using a predefined quality assessment framework

  • Apply Boolean minimization techniques to reduce complex contradiction patterns to their fundamental elements

3. Apply anti-pattern analysis for complex contradictions:
For complex datasets with multiple contradictions, implement the anti-pattern approach described by de Groot et al. :

  • Transform contradictory justifications into anti-patterns by replacing subject and object positions with variables

  • Analyze the support (sup(P)) of each anti-pattern, defined as the number of substitutions μ(P)

  • Use SPARQL queries to systematically identify patterns of contradiction across your dataset

4. Resolution strategies for contradictory findings:

5. Documentation and reporting guidelines:

  • Document all contradictions using the standardized notation system

  • Report both supporting and contradicting evidence

  • Provide detailed methodological information to facilitate resolution of contradictions

  • Generate testable hypotheses that could reconcile contradictory findings

By implementing this structured approach to contradiction analysis, researchers can transform seemingly incompatible findings into valuable insights about the context-dependent functions of Universal stress protein B, ultimately advancing our understanding of stress response mechanisms in bacteria.

What statistical approaches are most appropriate for analyzing the effects of uspB on bacterial stress responses?

1. Experimental Design Considerations:

  • Power analysis: Determine required sample size based on expected effect size, desired power (typically 0.8), and significance level (typically 0.05)

  • Randomization: Implement proper randomization to minimize selection bias

  • Blinding: Apply blinding procedures where possible to reduce observer bias

  • Controls: Include appropriate positive and negative controls, vehicle controls, and wild-type comparisons

2. Descriptive Statistics:

  • Summarize central tendency (mean, median) and dispersion (standard deviation, interquartile range)

  • Evaluate data distributions for normality using tests such as Shapiro-Wilk

  • Identify potential outliers using standardized residuals or Cook's distance

3. Inferential Statistics for Different Experimental Designs:

Experimental DesignAppropriate Statistical ApproachKey Considerations
Pre-post comparison (single group)Paired t-test or Wilcoxon signed-rank testLimited control for confounding variables
Multiple baseline designVisual analysis, percentage of non-overlapping data (PND), tau-UEvaluates experimental control across different baselines
Group comparison designsIndependent t-test, ANOVA, or non-parametric alternativesAccount for multiple comparisons using Bonferroni or FDR correction
Repeated measures designsRepeated measures ANOVA, mixed-effects modelsAddress potential violations of sphericity
Single-subject experimental designsVisual analysis supplemented with statistical approaches like Tau-U or HLMFocus on individual response patterns

4. Advanced Statistical Approaches:

  • Regression modeling: Analyze dose-response relationships or time-dependent effects

  • Survival analysis: Appropriate for time-to-event data (e.g., time until bacterial death under stress)

  • Multivariate methods: Principal component analysis or cluster analysis to identify patterns in complex stress responses

  • Bayesian approaches: Incorporate prior knowledge and update with experimental data

5. Specific Considerations for Stress Response Data:

  • Time series analysis: Account for temporal autocorrelation in stress response measures

  • Hierarchical modeling: Address nested data structures (e.g., colonies within plates, replicates within experiments)

  • Robust statistics: Consider methods resistant to outliers, which are common in stress response data

  • Effect size measures: Report standardized effect sizes (Cohen's d, Hedges' g) alongside p-values

6. Interpretation Guidelines:

  • Distinguish between statistical significance and biological significance

  • Consider adjustments for multiple comparisons when testing multiple hypotheses

  • Report confidence intervals alongside point estimates

  • Acknowledge limitations of statistical approaches used

By selecting appropriate statistical methods aligned with your experimental design, you can maximize the validity and interpretability of findings regarding uspB's role in bacterial stress responses.

How can I design experiments to investigate the relationship between uspB and pathogenicity in Escherichia coli O17:K52:H18?

Designing rigorous experiments to investigate the relationship between uspB and pathogenicity in Escherichia coli O17:K52:H18 requires a multifaceted approach that integrates molecular, cellular, and in vivo methods. Based on established research on uropathogenic E. coli strains and universal stress proteins , I recommend the following comprehensive experimental framework:

1. Genetic Manipulation Strategies:

  • Gene deletion: Generate clean uspB knockout mutants in E. coli O17:K52:H18 using lambda Red recombination or CRISPR-Cas9

  • Complementation: Reintroduce uspB under native or inducible promoters to confirm phenotypes

  • Point mutations: Create specific mutations in functional domains to identify critical residues

  • Reporter fusions: Develop uspB-reporter fusions to monitor expression during infection

2. In Vitro Virulence Assays:

  • Adhesion assays: Quantify adherence to relevant host cell types (uroepithelial, renal epithelial cells)

  • Invasion assays: Determine ability to invade host cells using gentamicin protection assays

  • Biofilm formation: Assess impact on biofilm development using crystal violet staining and confocal microscopy

  • Stress survival: Evaluate resistance to host-mimicking stresses (oxidative, nitrosative, pH, antimicrobial peptides)

3. Host-Pathogen Interaction Models:

  • Tissue culture infection models: Examine host cell responses using transcriptomics and cytokine profiling

  • Ex vivo organ culture: Utilize excised bladder or kidney tissue to assess colonization in a more complex environment

  • 3D organoid models: Employ organoids that recapitulate urinary tract architecture for infection studies

4. In Vivo Infection Models:

  • Murine urinary tract infection model: Assess colonization, persistence, and tissue damage

  • Ascending infection model: Evaluate progression from bladder to kidneys

  • Systemic infection model: Investigate the role of uspB in bacteremia and disseminated infection

  • Competition assays: Perform in vivo competition between wild-type and uspB mutant strains

5. Multi-Omics Analysis:

  • Transcriptomics: Compare gene expression profiles between wild-type and uspB mutants during infection

  • Proteomics: Identify proteins differentially expressed or modified in response to uspB activity

  • Metabolomics: Assess metabolic adaptations mediated by uspB during pathogenesis

6. Clinical Correlation Studies:

  • Analyze uspB expression in clinical isolates from different infection sites

  • Correlate uspB sequence variants with virulence phenotypes

  • Examine uspB expression during human infections through ex vivo sample analysis

Experimental Design Considerations:

  • Include appropriate controls (wild-type, complemented strains, unrelated gene deletions)

  • Use multiple independent biological replicates and technical replicates

  • Implement blinding procedures for in vivo studies to reduce bias

  • Apply rigorous statistical analysis, including power calculations for animal studies

This experimental framework allows for comprehensive characterization of uspB's role in the pathogenicity of E. coli O17:K52:H18, providing insights that may extend to other extraintestinal pathogenic E. coli (ExPEC) strains. Research by Johnson et al. has already demonstrated that E. coli O17:K52:H18 (strain UMN026) belongs to a pathogenic clonal group capable of causing diverse non-urinary tract infections, suggesting that factors like uspB may contribute to its versatile pathogenicity.

What are the methodological challenges in studying the evolutionary conservation of Universal stress proteins across bacterial species?

Studying the evolutionary conservation of Universal stress proteins across bacterial species presents several methodological challenges that require sophisticated approaches to overcome. Based on research in comparative genomics and evolutionary biology of stress response systems , the following challenges and methodological solutions are critical to consider:

1. Sequence Diversity and Homology Detection Challenges:

Challenges:

  • Low sequence similarity between distant homologs despite functional conservation

  • Distinguishing orthologs from paralogs, especially in gene families with multiple duplications

  • Presence of domain fusions and rearrangements across species

Methodological Solutions:

  • Apply position-specific iterative BLAST (PSI-BLAST) and hidden Markov models for sensitive homology detection

  • Implement phylogenetic approaches to distinguish orthologous from paralogous relationships

  • Utilize domain architecture analysis to identify homologous proteins with different domain compositions

  • Consider structure-based alignments when sequence conservation is limited

2. Functional Divergence Assessment:

Challenges:

  • Functional divergence despite sequence conservation

  • Limited experimental validation across diverse species

  • Context-dependent functions requiring different experimental approaches

Methodological Solutions:

  • Develop high-throughput complementation assays across species

  • Apply comparative phenomics to systematically assess stress response phenotypes

  • Use ancestral sequence reconstruction and resurrection to test functional evolution

  • Implement deep mutational scanning to map sequence-function relationships across homologs

3. Genomic Context Analysis:

Challenges:

  • Variable genomic organization around usp genes across species

  • Incomplete genome assemblies affecting synteny analysis

  • Horizontal gene transfer events confounding phylogenetic interpretations

Methodological Solutions:

  • Analyze conserved gene neighborhoods (synteny) across phylogenetically diverse genomes

  • Examine co-evolution patterns with interaction partners

  • Apply comparative transcriptomics to identify conserved regulons

  • Develop computational methods to detect horizontal gene transfer events

4. Structural Comparison Challenges:

Challenges:

  • Limited structural data for many Universal stress proteins

  • Relating structural differences to functional divergence

  • Integrating structural data with sequence and functional information

Methodological Solutions:

  • Apply homology modeling to predict structures for uncharacterized homologs

  • Utilize AlphaFold2 or similar AI-based structure prediction tools

  • Implement molecular dynamics simulations to study structural flexibility

  • Develop structural classification systems specific to Universal stress proteins

5. Integrative Evolutionary Analysis:

Challenges:

  • Reconciling data from multiple sources with different evolutionary rates

  • Correcting for phylogenetic non-independence in comparative analyses

  • Dating evolutionary events in the history of Universal stress proteins

Methodological Solutions:

  • Apply phylogenetic comparative methods to account for shared evolutionary history

  • Implement Bayesian approaches for estimating evolutionary rates and dating divergence

  • Develop integrative models combining sequence, structure, and functional data

  • Use ancestral state reconstruction to infer the evolution of functional traits

6. Data Integration and Visualization:

Challenges:

  • Managing heterogeneous data types from diverse species

  • Visualizing complex evolutionary relationships

  • Comparing results across different analytical methods

Methodological Solutions:

  • Develop specialized databases for Universal stress proteins

  • Implement interactive visualization tools for comparative genomic data

  • Utilize network approaches to visualize functional relationships across species

  • Apply machine learning for pattern recognition in evolutionary data

By addressing these methodological challenges through the proposed solutions, researchers can develop a more comprehensive understanding of how Universal stress proteins have evolved and diversified across bacterial species, providing insights into their fundamental roles in stress adaptation and pathogenicity.

What are common pitfalls in experimental design when studying uspB, and how can they be avoided?

When studying Universal stress protein B (uspB), researchers frequently encounter several experimental design pitfalls that can compromise data quality and interpretation. Based on established methodological principles , the following common pitfalls and corresponding solutions should be considered:

Inadequate Experimental Controls

Pitfall: Insufficient or inappropriate controls leading to misinterpretation of uspB-specific effects.

Solution:

  • Include multiple control types: negative controls (vector-only, unrelated protein), positive controls (known stress response proteins), and isogenic controls (parent strain)

  • Implement genetic complementation controls to confirm phenotype specificity

  • Use scrambled or non-targeting controls for RNA interference experiments

  • Account for plasmid copy number effects when expressing recombinant uspB

Non-physiological Expression Levels

Pitfall: Overexpression artifacts or insufficient expression leading to misleading functional characterization.

Solution:

  • Use native promoters or tunable expression systems

  • Quantify expression levels relative to physiological conditions

  • Consider chromosomal integration instead of plasmid-based expression

  • Validate protein levels by western blot to ensure appropriate expression

Stress Condition Standardization Issues

Pitfall: Variable stress conditions between experiments leading to inconsistent results.

Solution:

  • Develop standardized stress exposure protocols with precise definitions of stress intensity and duration

  • Calibrate stress conditions to physiological relevance

  • Use dose-response approaches rather than single stress conditions

  • Monitor environmental variables (pH, temperature, oxygen levels) throughout experiments

Overlooking Strain-Specific Variations

Pitfall: Generalizing findings from laboratory strains to pathogenic isolates without validation.

Solution:

  • Compare uspB function across multiple strains, including clinical isolates

  • Document strain backgrounds comprehensively in methods sections

  • Consider genomic context differences that might affect uspB function

  • Test key findings in E. coli O17:K52:H18 (strain UMN026) specifically when studying pathogenic applications

Single Timepoint Analysis

Pitfall: Missing temporal dynamics of uspB-mediated responses by examining only single timepoints.

Solution:

  • Implement time-course experiments to capture dynamic responses

  • Consider both immediate and adaptive stress responses

  • Use real-time monitoring approaches where feasible

  • Apply appropriate statistical methods for time-series data

Inadequate Sample Size and Power

Pitfall: Insufficient statistical power leading to false negatives or overinterpretation of results.

Solution:

  • Conduct a priori power analysis to determine appropriate sample sizes

  • Report effect sizes alongside statistical significance

  • Consider biological variability when planning replicates

  • Distinguish between technical and biological replication

Overlooking Functional Redundancy

Pitfall: Failing to account for compensatory mechanisms through other usp genes.

Solution:

  • Generate and analyze multiple and combinatorial usp gene knockouts

  • Assess expression changes in other usp genes when manipulating uspB

  • Consider conditional knockouts if complete deletions show no phenotype

  • Apply systems biology approaches to model pathway redundancy

Isolation vs. Integration Issues

Pitfall: Studying uspB in isolation without considering its interaction network.

Solution:

  • Identify and characterize interaction partners

  • Consider downstream effectors and upstream regulators

  • Integrate uspB studies with broader stress response pathways

  • Apply network analysis approaches to position uspB in cellular response networks

By proactively addressing these common pitfalls through the recommended solutions, researchers can significantly improve the reliability and reproducibility of uspB studies, ultimately contributing to a more comprehensive understanding of this important stress response protein.

What are the key considerations for ensuring reproducibility in research involving recombinant Escherichia coli O17:K52:H18 Universal stress protein B?

Ensuring reproducibility in research involving recombinant Escherichia coli O17:K52:H18 Universal stress protein B requires meticulous attention to detail across multiple experimental dimensions. Based on established best practices in protein biochemistry and microbiology , the following key considerations should be implemented:

Protein Production and Characterization

Documentation requirements:

  • Complete sequence information including expression region (1-111 for uspB)

  • Tag information and its potential impact on function

  • Expression system details (bacterial, yeast, mammalian)

  • Purification protocol with step-by-step conditions

  • Final purity assessment (>85% by SDS-PAGE is recommended)

  • Batch-to-batch variation monitoring

Standardization practices:

  • Use consistent expression systems across experiments

  • Implement quality control checkpoints throughout purification

  • Verify protein identity using mass spectrometry

  • Assess functional activity with standardized assays

Storage and Stability Management

Critical parameters:

  • Storage buffer composition (Tris-based buffer with 50% glycerol)

  • Storage temperature protocols (-20°C/-80°C for long-term; 4°C for working solutions)

  • Freeze-thaw cycle tracking and limitations

  • Shelf-life documentation (6 months for liquid form, 12 months for lyophilized form)

  • Aliquoting strategy to minimize freeze-thaw cycles

Verification approaches:

  • Periodically verify protein activity after storage

  • Document protein concentration before each experiment

  • Implement stability-indicating assays

  • Maintain control samples from characterized batches

Experimental Conditions Reporting

Minimum reporting standards:

  • Detailed buffer compositions with exact pH values

  • Temperature conditions during all experimental steps

  • Incubation times with precise durations

  • Reagent sources, catalog numbers, and lot numbers

  • Equipment specifications and calibration status

Environmental controls:

  • Monitor and report laboratory temperature and humidity

  • Document light exposure conditions if relevant

  • Control for batch effects through experimental design

  • Standardize plate reader or spectrophotometer settings

Data Collection and Processing Transparency

Documentation requirements:

  • Raw data preservation and accessibility

  • Pre-processing steps with detailed parameters

  • Statistical analysis methods with justification

  • Software versions and settings

  • Inclusion/exclusion criteria for data points

Reproducibility enhancement:

  • Use electronic laboratory notebooks

  • Implement standardized data collection templates

  • Pre-register experimental protocols when appropriate

  • Share analysis code and data processing workflows

Biological System Standardization

Critical considerations:

  • Bacterial strain verification (confirm O17:K52:H18 serotype)

  • Growth media composition with exact formulations

  • Culture conditions (temperature, aeration, vessel type)

  • Growth phase standardization for harvesting

  • Antibiotic selection pressure documentation

Verification approaches:

  • Periodic strain authentication

  • Contamination monitoring protocols

  • Growth curve characterization

  • Stress response benchmarking against reference strains

Methodological Transparency Framework

ComponentEssential DocumentationVerification Approach
Protein IdentityAccession number (B7NEC5) , full sequenceMass spectrometry
Protein PurityPurification method, final purity percentageSDS-PAGE, size exclusion chromatography
Storage ConditionsBuffer composition, temperature, durationActivity assays before use
Expression SystemHost organism, vector, induction conditionsYield consistency checking
Experimental BuffersComplete formulation with pHpH verification before use
Bacterial CulturesMedia, growth conditions, optical densityGrowth curve monitoring

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.