Recombinant Escherichia coli O17:K52:H18 UPF0059 membrane protein yebN (yebN)

Shipped with Ice Packs
In Stock

Description

Introduction to UPF0059 Membrane Protein YebN

The UPF0059 membrane protein yebN, also known as mntP in certain contexts, is a membrane-bound protein found in various strains of Escherichia coli . The specific variant examined in this article is derived from E. coli O17:K52:H18 (strain UMN026/ExPEC), a pathogenic strain associated with extraintestinal infections . This protein belongs to the UPF0059 family, a grouping of membrane proteins with conserved structures across bacterial species .

YebN represents an important class of bacterial integral membrane proteins that function in the transport of substances across cell membranes. Based on current research, this protein appears to function primarily as a manganese efflux pump, playing a crucial role in maintaining proper manganese homeostasis within bacterial cells . The maintenance of appropriate metal ion concentrations is essential for bacterial survival, as both deficiency and excess of metal ions can be detrimental to cellular processes.

Protein Sequence and Structure

The yebN protein from E. coli O17:K52:H18 has a defined amino acid sequence that contributes to its functional capabilities. The primary structure consists of 188 amino acids with the following sequence:

MNITATVLLAFGMSMDAFAASIGKGATLHKPKFSEALRTGLIFGAVETLTPLIGWGMGMLASRFVLEWNHWIAFVLLIFLGGRMIIEGFRGADDEDEEPRRRHGFWLLVTTAIATSLDAM AVGVGLAFLQVNIIATALAIGCATLIMSTLGMMVGRFIGSIIGKKAEILGGLVLIGIGVQILWTHFHG

This sequence is characteristic of membrane proteins, with hydrophobic regions that likely span the cell membrane multiple times. The protein's Uniprot identification number is B7NBG8, which allows researchers to access additional information about this protein in biological databases .

Role as a Manganese Efflux Pump

As a manganese efflux system, yebN likely contributes to maintaining appropriate intracellular manganese concentrations by exporting excess ions. This function places yebN among the critical components of bacterial metal ion homeostasis systems, which include both import and export mechanisms for essential metals.

Significance in Bacterial Physiology

The regulation of proteins like yebN may be influenced by post-translational modifications such as acetylation and deacetylation. While not specifically studied for yebN, research on other E. coli proteins demonstrates that lysine acetylation can affect protein function, and deacetylases like CobB can reverse these modifications . Such mechanisms could potentially regulate yebN activity in response to changing cellular conditions.

Tools for Membrane Protein Research

Recombinant yebN serves as a valuable tool for studying membrane protein structure and function. As membrane proteins represent approximately 30% of all proteins and constitute important targets for drug development, systems for producing and studying these proteins are of considerable scientific interest. The availability of purified recombinant yebN enables investigations into:

  • Membrane protein folding and stability

  • Mechanisms of ion transport across membranes

  • Structure-function relationships in transport proteins

  • Development of expression and purification methods for membrane proteins

Significance in Understanding Bacterial Metal Homeostasis

The study of yebN contributes to broader understanding of bacterial metal ion homeostasis, which is increasingly recognized as an important aspect of bacterial physiology and pathogenesis. Metal transport systems like yebN may influence:

  • Bacterial survival under varying environmental conditions

  • Resistance to host defense mechanisms that involve metal sequestration

  • Potential targets for novel antimicrobial approaches

Post-translational Modifications and Regulation

While not directly related to yebN, research on E. coli proteins has demonstrated the significance of post-translational modifications in regulating protein function. For example, studies on topoisomerase I have shown that lysine acetylation can decrease enzymatic activity, and that the deacetylase CobB can reverse this effect . Similar regulatory mechanisms might potentially apply to membrane transporters like yebN, though specific studies on yebN acetylation are not evident in the available literature.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
mntP; yebN; ECUMN_2114; Probable manganese efflux pump MntP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-188
Protein Length
full length protein
Species
Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Target Names
mntP
Target Protein Sequence
MNITATVLLAFGMSMDAFAASIGKGATLHKPKFSEALRTGLIFGAVETLTPLIGWGMGML ASRFVLEWNHWIAFVLLIFLGGRMIIEGFRGADDEDEEPRRRHGFWLLVTTAIATSLDAM AVGVGLAFLQVNIIATALAIGCATLIMSTLGMMVGRFIGSIIGKKAEILGGLVLIGIGVQ ILWTHFHG
Uniprot No.

Target Background

Function

This protein likely functions as a manganese efflux pump.

Database Links
Protein Families
MntP (TC 9.B.29) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What determines membrane protein integration efficiency for proteins like yebN?

Membrane protein integration is significantly influenced by the characteristics of transmembrane domains (TMDs). Research indicates that TMDs containing polar and/or charged residues present challenges for membrane integration. Analysis of EMC-dependent proteins reveals that they all contain at least one TMD with polar and/or charged residues that are energetically unfavorable for membrane insertion .

Methodological approach:

  • Analyze the hydrophobicity profile of each TMD within your membrane protein

  • Identify all polar and charged residues within TMDs

  • Compare hydrophobicity scores against established thresholds for spontaneous membrane insertion

  • Consider using complementary experimental approaches like protease protection assays to confirm topology

For yebN specifically, examining TMD composition would help predict whether specialized membrane integration machinery might be required for proper expression and localization.

How do transmembrane domains affect membrane protein stability?

Transmembrane domains with polar or charged residues can significantly impact protein stability. These residues create energetically unfavorable interactions within the hydrophobic membrane environment, potentially leading to misfolding or improper integration.

Research has shown that multiple subunits of membrane protein complexes like V-ATPase (ATP6V0A1, ATP6V0C, and TCIRG1) require specialized integration machinery due to challenging TMDs . For proteins like yebN, stability may depend on:

  • The specific positioning of polar/charged residues within TMDs

  • Interactions between multiple TMDs that can stabilize otherwise unfavorable residues

  • Association with membrane protein complexes that provide structural support

To experimentally assess stability, researchers should monitor protein levels over time, perform thermal shift assays, and examine resistance to detergent solubilization.

What cellular machinery assists in the integration of membrane proteins with challenging TMDs?

The endoplasmic reticulum membrane protein complex (EMC) plays a crucial role in the biogenesis and membrane integration of transmembrane proteins with challenging TMDs. The EMC helps integrate TMDs containing polar and/or charged residues that would otherwise be energetically unfavorable for membrane insertion .

For E. coli membrane proteins like yebN, homologous machinery may exist to facilitate proper integration. Methodological approaches to study this include:

  • Generating EMC-deficient cell lines (e.g., EMC4-Mut, EMC6-KO) to test dependency

  • Comparing protein expression levels between wild-type and machinery-deficient cells

  • Performing rescue experiments by co-expressing machinery components

  • Using mutagenesis to modify TMD composition and test effects on dependency

Research demonstrates that EMC dependency can be experimentally verified through these approaches, providing a framework for studying yebN integration .

How can researchers design effective mutagenesis studies to investigate membrane protein topology and function?

Effective mutagenesis strategies for membrane proteins require systematic approaches based on TMD characteristics:

  • Strategic mutation design:

    • To test membrane integration: Replace polar/charged residues with hydrophobic ones (e.g., S→L, R→L)

    • To test EMC dependency: Introduce polar residues into hydrophobic TMDs

    • To investigate functional domains: Use conservative substitutions that maintain charge but alter properties

  • Experimental validation framework:

    • Compare expression levels of mutants in wild-type cells to ensure mutations don't affect stability

    • Verify membrane topology is maintained despite mutations

    • Test for altered dependency on integration machinery

Research has demonstrated the effectiveness of this approach. For example, replacing polar residues S397L, Q399L, T402L, and T403L in FDFT1's C-terminal TMD converted an EMC-dependent protein to EMC-independent . Similar approaches could be applied to yebN to understand its integration requirements.

Mutation StrategyExamplesApplicationsControls Needed
Polarity reductionS→L, T→L, Q→LTest EMC dependencyExpression level verification
Polarity introductionF→Y, L→N, I→TConvert EMC-independent to dependentTopology confirmation
Charge modificationR→L, K→LTest charge importanceFunctional assays
Multiple substitutionsS284L/R285LTest synergistic effectsIndividual mutation testing

What approaches can resolve contradictory results when studying membrane protein expression?

Resolving contradictory results requires a multi-faceted approach:

  • Experimental variable isolation:

    • Systematically test whether contradictions arise from expression conditions, detection methods, or protein constructs

    • Compare results across different expression systems

    • Evaluate the impact of fusion tags on protein behavior

  • Comprehensive validation:

    • Use multiple detection methods (Western blot, fluorescence, mass spectrometry)

    • Perform rescue experiments in knockout systems

    • Test under various physiological conditions

Research on membrane proteins demonstrates how experimental design can influence results. For example, adding a 3xFLAG tag to the C-terminus of FDFT1 altered its EMC dependency, suggesting that tag position can significantly impact membrane protein behavior .

When studying yebN, researchers should be particularly careful about:

  • Tag position and size (N-terminal versus C-terminal)

  • Expression level variations across experimental conditions

  • The distance between TMDs and protein termini

How can advanced proteomics approaches be optimized for membrane protein research?

Optimizing proteomics for membrane proteins requires specialized approaches:

  • Sample preparation optimization:

    • Use detergents compatible with mass spectrometry (e.g., RapiGest, ProteaseMAX)

    • Employ filter-aided sample preparation (FASP) for membrane protein digestion

    • Consider specialized membrane protein extraction techniques

  • MS analysis parameters:

    • Optimize collision energies for hydrophobic peptides

    • Use longer chromatography gradients for better separation

    • Consider alternative proteases beyond trypsin for membrane regions

  • Data analysis considerations:

    • Apply specialized normalization methods for membrane proteins

    • Use targeted approaches for low-abundance membrane proteins

    • Implement transmembrane topology prediction in analysis workflows

Research demonstrates the value of MS-based quantitative proteomic analysis for membrane proteins. Studies comparing EMC-deficient cells to wild-type cells successfully identified 36 EMC-dependent membrane proteins and 171 EMC-independent membrane proteins .

What expression systems are optimal for recombinant E. coli membrane proteins like yebN?

Selecting the appropriate expression system depends on research objectives:

  • Homologous E. coli expression:

    • Advantages: Native membrane environment, potentially high yields

    • Recommended strains: C41(DE3), C43(DE3), Lemo21(DE3)

    • Optimization parameters: Induction temperature (16-25°C), inducer concentration (0.1-0.5 mM IPTG)

  • Cell-free expression systems:

    • Advantages: Rapid production, direct incorporation into nanodiscs

    • Components: E. coli S30 extract supplemented with lipids/detergents

    • Applications: Initial screening, toxic membrane proteins

For membrane proteins with challenging TMDs, expression conditions should be optimized to ensure proper integration. Low-temperature induction and reduced inducer concentrations can improve folding efficiency .

How should experiments be designed to determine whether a membrane protein depends on specialized integration machinery?

To determine dependency on specialized integration machinery, implement this experimental workflow:

  • Generate cellular models with machinery deficiencies:

    • Create knockout cell lines (e.g., EMC4-Mut, EMC6-KO)

    • Include rescue controls by reintroducing knocked-out components

  • Compare protein expression across models:

    • Analyze protein levels via immunoblotting

    • Examine membrane fraction enrichment

    • Use quantitative proteomics for unbiased assessment

  • Perform validation experiments:

    • Co-transfect with machinery components to restore expression

    • Monitor unfolded protein response markers (e.g., BiP/GRP78)

Research demonstrates that comparing protein levels in wild-type versus EMC-deficient cells, followed by rescue experiments, effectively determines EMC dependency. For example, expression of FZD7 in EMC4-Mut cells can be restored when EMC4 is re-expressed via transfection .

What controls are essential when studying the effects of TMD mutations?

Essential controls for TMD mutation studies include:

Research has shown that overexpressing EMC-dependent proteins (like FZD4 or FZD7) in EMC-deficient cells increases BiP expression, while overexpressing EMC-independent proteins (like SYT1) does not affect BiP levels . This provides a valuable control strategy for assessing proper integration.

How can researchers differentiate between membrane integration defects and protein stability issues?

Differentiating between integration defects and stability issues requires multiple experimental approaches:

Experimental ApproachIntegration Defect SignatureStability Issue Signature
Pulse-chase analysisLittle labeled protein detected initiallyNormal initial labeling followed by rapid decrease
Subcellular fractionationProtein detected in incorrect fractionReduced levels in correct fraction
Proteasome inhibitionMinimal effect on protein levelsSignificant increase in protein levels
UPR marker analysisModerate BiP inductionStrong BiP induction

What bioinformatic approaches can predict whether mutations will affect membrane protein integration?

Bioinformatic approaches for predicting mutation impacts include:

  • TMD prediction and analysis:

    • Use specialized algorithms (TMHMM, HMMTOP) to predict transmembrane regions

    • Calculate hydrophobicity scores for each TMD

    • Identify polar/charged residues within predicted TMDs

  • Membrane insertion energetics:

    • Calculate ΔG for TMD membrane insertion

    • Compare wild-type and mutant insertion energetics

    • Identify threshold values for EMC dependency

  • Comparative sequence analysis:

    • Align orthologous sequences to identify conserved polar/charged residues

    • Evaluate evolutionary conservation of residue properties within TMDs

    • Identify co-evolving residue networks that might compensate for unfavorable residues

These predictions should be validated experimentally. Research demonstrates that polar and charged residues in TMDs can be identified computationally and targeted for mutagenesis to alter EMC dependency .

How should researchers interpret dynamic membrane protein behavior across different experimental conditions?

Interpreting dynamic membrane protein behavior requires systematic analysis:

  • Condition-dependent pattern recognition:

    • Map expression patterns across different conditions

    • Identify threshold effects in protein behavior

    • Determine whether changes are gradual or switch-like

  • Multi-parameter correlation analysis:

    • Correlate protein expression with:

      • Membrane composition parameters

      • Cellular stress indicators

      • Expression levels of integration machinery components

    • Use multivariate statistics to identify key influencing factors

  • Integrated data interpretation framework:

    • Consider partial dependencies versus absolute requirements

    • Evaluate compensatory mechanisms that may explain condition-dependent behavior

    • Develop predictive models that account for multiple variables

Research demonstrates that membrane protein behavior can be condition-dependent. For example, WT FDFT1 fused with a 3xFLAG tag at its C-terminus showed similar expression levels across both EMC-deficient and WT cells, while untagged FDFT1 was EMC-dependent . This highlights how seemingly minor experimental variations can dramatically impact results.

How can researchers overcome low expression issues with recombinant membrane proteins?

Low expression of membrane proteins can be addressed through:

  • Expression system optimization:

    • Test multiple E. coli strains designed for membrane protein expression

    • Optimize codon usage for the host organism

    • Consider fusion partners that enhance expression (e.g., MBP, SUMO)

  • Growth condition modifications:

    • Reduce induction temperature (16-20°C)

    • Use lower inducer concentrations

    • Add membrane-stabilizing compounds (glycerol, specific lipids)

  • Construct design improvements:

    • Remove or relocate challenging TMDs

    • Introduce mutations to increase hydrophobicity of TMDs

    • Consider expressing functional domains separately

Research indicates that proteins with TMDs containing polar/charged residues often show low expression due to integration challenges. Modifying these residues can improve expression levels, as demonstrated with proteins like FDFT1, ZFPL1, and CD9 .

What strategies can help resolve membrane protein aggregation during purification?

Resolving membrane protein aggregation requires:

  • Detergent optimization:

    • Screen multiple detergent types (mild non-ionic, zwitterionic)

    • Test detergent mixtures for synergistic effects

    • Consider lipid-detergent mixed micelles

  • Buffer composition refinement:

    • Optimize ionic strength and pH

    • Add stabilizing agents (glycerol, specific lipids)

    • Consider chaotropic agents at low concentrations

  • Temperature and handling modifications:

    • Maintain samples at 4°C throughout purification

    • Minimize freeze-thaw cycles

    • Consider on-column detergent exchange

Understanding TMD characteristics can guide detergent selection. Proteins with polar/charged residues in TMDs often require specific detergent conditions to maintain native conformation and prevent aggregation .

What emerging technologies are changing our understanding of membrane protein integration?

Emerging technologies advancing membrane protein research include:

  • Cryo-electron microscopy advancements:

    • Single-particle analysis of membrane protein complexes

    • Visualization of membrane protein insertion intermediates

    • Structural determination of integration machinery components

  • Integrative structural biology approaches:

    • Combining computational modeling with experimental constraints

    • Hydrogen-deuterium exchange mass spectrometry for dynamics

    • Cross-linking mass spectrometry for interaction mapping

  • High-throughput mutagenesis technologies:

    • Deep mutational scanning of TMDs

    • CRISPR-based screens for integration factors

    • Massively parallel reporter assays for TMD function

These approaches are revealing how factors like the EMC facilitate the integration of challenging TMDs containing polar and charged residues, providing a framework for understanding membrane proteins like yebN .

How might findings from membrane protein integration studies inform therapeutic development?

Membrane protein integration research has significant therapeutic implications:

  • Drug development applications:

    • Targeting membrane protein biogenesis machinery

    • Developing compounds that stabilize mutant membrane proteins

    • Designing peptides that assist in membrane integration

  • Recombinant protein production improvements:

    • Enhancing expression of therapeutic membrane proteins

    • Optimizing membrane protein folding and stability

    • Developing improved cellular factories for membrane protein production

  • Disease mechanism insights:

    • Understanding how mutations in TMDs lead to protein deficiencies

    • Identifying compensatory mechanisms for rescue approaches

    • Developing targeted therapies for membrane protein disorders

Research demonstrating how polar and charged residues affect membrane protein integration provides a foundation for therapeutic approaches targeting these processes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.