Recombinant Escherichia coli O17:K52:H18 UPF0208 membrane protein YfbV (yfbV)

What is the basic structure and characterization of YfbV protein?

YfbV is a 151-amino acid membrane protein belonging to the UPF0208 family in Escherichia coli O17:K52:H18. Its complete amino acid sequence is: MSTPDNRSVNFFSLFRRGQHYSKTWPLEKRLAPVFVENRVIKMTRYAIRFMPPIAVFTLCWQIALGGQLGPAVATALFALSLPMQGLWWLGKRSVTPLPPAILNWFYEVRGKLQESGQVLAPVEGKPDYQALADTLKRAFKQLDKTFLDDL . The protein contains hydrophobic regions that facilitate membrane insertion and anchoring. Preliminary analysis suggests it may have similar structural features to other bacterial membrane proteins involved in cell division or membrane organization.

How does the sequence of YfbV compare to homologous proteins in other bacterial species?

While the search results don't provide direct homology comparisons, methodologically, researchers should perform sequence alignments using tools like BLAST against protein databases. Of interest, the E. coli protein YtfB shows homology to the virulence factor OapA from Haemophilus influenzae, which is important for adherence to epithelial cells . Similar comparative analysis of YfbV could reveal functional homologs in other bacterial species, potentially indicating conserved functions across species barriers.

What expression systems yield optimal results for recombinant YfbV production?

The recombinant YfbV protein has been successfully expressed in E. coli expression systems with an N-terminal His tag, suggesting homologous expression works effectively for this membrane protein . When designing expression systems for membrane proteins like YfbV, consider:

• Using E. coli BL21(DE3) or similar strains optimized for membrane protein expression

• Testing induction conditions (temperature, IPTG concentration, induction time)

• Employing specialized vectors with tunable promoters to control expression levels

• Including fusion partners that may enhance folding and membrane insertion

How can statistical models improve expression success rates for membrane proteins like YfbV?

The IMProve statistical model has been developed specifically to predict expression success for integral membrane proteins (IMPs) in E. coli. The model combines sequence-derived features to generate an "IMProve score," where higher values indicate higher probability of successful expression . Implementation of this model can more than double the number of successfully expressed membrane protein targets in experimental settings. For YfbV variants or homologs:

• Input the protein sequence into the IMProve algorithm

• Assess the resulting score as a predictor of expression success

• Prioritize constructs with higher IMProve scores

• Modify sequences with low scores to improve predicted expression levels

This data-driven approach represents a significant advancement over traditional trial-and-error methods, providing a rational basis for construct design .

What are the critical considerations when designing qPCR experiments to study yfbV gene expression?

When studying yfbV gene expression using qPCR, researchers must implement a robust experimental design that accounts for the challenges of studying membrane protein genes:

• Follow MIQE guidelines (Minimum Information for Publication of Quantitative Real-Time PCR Experiments) to ensure reproducibility across laboratories

• Carefully design primers that:

  • Avoid regions with SNPs that might affect primer binding

  • Target conserved regions specific to yfbV

  • Generate amplicons of optimal size (approximately 100 bases)

  • Avoid secondary structures that may impair amplification

• Include appropriate controls:

  • Multiple stable reference genes (not only GAPDH or ACTB)

  • No-template controls

  • Reverse transcriptase negative controls

  • Positive controls with known expression levels

• Implement sufficient biological and technical replicates to capture both biological variability and ensure technical accuracy

What storage and handling protocols optimize YfbV protein stability for research applications?

Based on empirical data, recombinant YfbV protein requires specific handling to maintain stability:

• Store lyophilized protein at -20°C/-80°C upon receipt

• Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

• Add glycerol to a final concentration of 5-50% (recommended default: 50%) for long-term storage

• Aliquot to avoid repeated freeze-thaw cycles, which significantly impact protein integrity

• Working aliquots can be maintained at 4°C for up to one week

• For buffer exchanges, use Tris/PBS-based buffer with 6% Trehalose, pH 8.0

What methodologies can determine potential roles of YfbV in bacterial pathogenesis?

To investigate YfbV's potential role in pathogenesis, researchers should implement a multifaceted approach:

• Gene knockout studies to assess phenotypic changes in virulence-related traits

• Glycan binding assays to determine if YfbV, like YtfB, binds to specific glycan structures

• Adhesion assays with epithelial cell lines to assess impacts on bacterial attachment

• Complementation studies to confirm phenotypes are specific to yfbV deletion

• Transcriptomic analysis comparing wild-type and ΔyfbV strains under infection-relevant conditions

• Animal infection models to assess in vivo significance

The finding that YtfB plays a role in adherence of uropathogenic E. coli to host cells suggests similar functional analyses would be valuable for YfbV .

How can low abundance of YfbV be addressed in expression and detection systems?

For membrane proteins like YfbV that often express at low levels, implement these methodological approaches:

• Optimize codon usage for the expression host

• Use two-step RT-qPCR protocols for gene expression analysis

• Perform preamplification of RNA or first-strand cDNA to increase detectable target amounts

• Employ specialized membrane protein purification techniques:

  • Detergent screening to identify optimal solubilization conditions

  • Affinity purification using the N-terminal His tag

  • Size exclusion chromatography to separate oligomeric states

• For detection:

  • Use sensitive Western blot methods with enhanced chemiluminescence

  • Consider proximity labeling approaches for interaction studies

  • Implement super-resolution microscopy for localization studies

What approaches can identify potential interaction partners of YfbV in the bacterial membrane?

For comprehensive identification of YfbV interaction partners:

• Membrane-based yeast two-hybrid systems adapted for bacterial membrane proteins

• Co-immunoprecipitation with membrane-compatible detergents

• Bacterial two-hybrid assays

• Chemical crosslinking followed by mass spectrometry

• Proximity labeling methods (BioID, APEX) to identify proteins in close spatial proximity

• STRING database analysis to predict potential interactions based on network analysis

The finding that YtfB interacts with cell division protein DamX and other hypothetical fimbrial-like proteins suggests similar approaches could reveal YfbV's interaction network.

What are effective strategies for crystallizing membrane proteins like YfbV for structural studies?

Crystallization of membrane proteins presents unique challenges requiring specialized approaches:

• Detergent screening to identify conditions that maintain native structure

• Lipidic cubic phase (LCP) crystallization methods

• Incorporation of stabilizing mutations or truncations to remove flexible regions

• Use of antibody fragments or nanobodies to stabilize conformations

• Reconstitution into nanodiscs to mimic membrane environment

• Cryo-electron microscopy as an alternative to crystallization

For YfbV specifically, starting with the successfully purified recombinant form with N-terminal His tag provides a foundation for structural studies.

How can site-directed mutagenesis elucidate functional domains within YfbV?

A systematic mutagenesis approach would include:

• Sequence alignment with homologous proteins to identify conserved residues

• Secondary structure prediction to identify transmembrane regions

• Targeted mutations of:

  • Conserved residues in predicted functional domains

  • Charged residues in transmembrane regions

  • Residues at predicted protein-protein interaction interfaces

• Expression and purification of mutant proteins following established protocols

• Functional assays to assess impact on:

  • Membrane localization

  • Protein stability

  • Protein-protein interactions

  • Bacterial phenotypes (growth, division, pathogenesis)

How should researchers address contradictory results in YfbV expression studies?

When facing contradictory results:

• Assess RNA quality and integrity using bioanalyzer or gel electrophoresis

• Evaluate reference gene stability across experimental conditions using algorithms like geNorm or NormFinder

• Examine biological variability through increased biological replicates

• Analyze technical aspects:

  • Primer design and specificity

  • Amplification efficiency

  • Reaction conditions optimization

• Consider post-transcriptional regulatory mechanisms affecting protein levels

• Evaluate detection method sensitivity, especially for low-abundance membrane proteins

What bioinformatic tools best predict functional properties of YfbV based on sequence?

For comprehensive sequence-based functional prediction:

• Transmembrane topology prediction tools (TMHMM, Phobius)

• Protein family classification (Pfam, InterPro)

• Conserved domain analysis (CDD, SMART)

• Protein-protein interaction prediction (STRING)

• Structural modeling using tools like AlphaFold or I-TASSER

• Functional site prediction (active sites, binding pockets)

• IMProve algorithm to assess expression potential

Combined, these approaches can generate testable hypotheses about YfbV function based purely on sequence information, guiding experimental design.