Recombinant Escherichia coli O17:K52:H18 UPF0259 membrane protein yciC (yciC)

Shipped with Ice Packs
In Stock

Description

Role in Pathogenicity

  • yciC is linked to the APEC (avian pathogenic E. coli) pathotype. Genome-wide association studies (GWAS) identified yciC as significantly enriched in APEC isolates compared to AFEC (avian fecal E. coli), suggesting a role in virulence .

  • Protein interaction networks place yciC in Cluster 8, associated with intracellular septation and uncharacterized protein families (P = 0.0033) .

Metal Ion Homeostasis

  • Homologs of yciC in Bacillus subtilis are regulated by Zur (zinc uptake regulator) and hypothesized to function as metallochaperones, though its exact role in E. coli remains under investigation .

Membrane Protein Insertion

  • While not directly studied for yciC, E. coli YidC—a membrane insertase—facilitates the integration of multi-pass transmembrane proteins like yciC. The holo-translocon (HTL) complex (SecYEG–SecDF–YajC–YidC) enhances membrane protein insertion efficiency .

Research Reagent

  • Recombinant yciC is commercially available for ELISA, antibody production, and structural studies. Key specifications include:

    • Purity: >90% by SDS-PAGE .

    • Storage: -20°C in Tris buffer with 50% glycerol; avoid freeze-thaw cycles .

GWAS and Pathogenicity

  • A 2023 study identified yciC as a novel candidate gene in APEC isolates, with a prevalence ratio of 1.64 (APEC vs. AFEC). This correlates with enhanced survival in hostile host environments .

  • Protein interaction networks suggest yciC interacts with septation-related proteins, though mechanistic details are unresolved .

Regulatory Mechanisms

  • In B. subtilis, yciC repression requires two Zur-binding sites (C1 and C2), with Zur recognizing a 9-1-9 inverted repeat motif—a larger operator than typical Fur-family regulators .

Future Research Directions

  1. Functional Characterization: Elucidate yciC’s role in metal ion trafficking or septation using knockout strains .

  2. Structural Analysis: Cryo-EM studies to resolve transmembrane topology and interaction partners .

  3. Comparative Genomics: Assess yciC distribution across E. coli pathotypes (e.g., UPEC, APEC) to identify conserved virulence mechanisms .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing your order, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery details.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your use.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and protein stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please let us know, and we will prioritize developing the specified tag.
Synonyms
yciC; ECUMN_1554; UPF0259 membrane protein YciC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Target Names
yciC
Target Protein Sequence
MSITAQSVYRDTGNFFRNQFMTILLVSLLCAFITVVLGHVFSPSDAQLAQLNDGVPVSGS SGLFDLVQNMSPEQQQILLQASAASTFSGLIGNAILAGGVILIIQLVSAGQRVSALRAIG ASAPILPKLFILIFLTTLLVQIGIMLVVVPGIIMAILLALAPVMLVQDKMGVFASMRSSM RLTWANMRLVAPAVLSWLLAKTLLLLFASSFAALTPEIGAVLANTLSNLISAVLLIYLFR LYMLIRQ
Uniprot No.

Target Background

Database Links
Protein Families
UPF0259 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How is recombinant yciC typically expressed and purified for research applications?

Recombinant yciC is typically expressed in E. coli expression systems with fusion tags to facilitate purification. The most common approach involves adding an N-terminal His-tag to the protein, which enables purification through nickel affinity chromatography . The general protocol involves:

  • Cloning the yciC gene into an expression vector with an appropriate tag

  • Transforming this construct into a suitable E. coli strain

  • Inducing protein expression under optimized conditions

  • Lysing cells and purifying the protein through affinity chromatography

  • Further purification steps may include size exclusion chromatography or ion exchange

The purified protein is typically stored in a Tris/PBS-based buffer with stabilizing agents such as trehalose (6%) at a pH of 8.0 . For long-term storage, it is recommended to add glycerol (30-50% final concentration) and store at -20°C/-80°C in aliquots to avoid repeated freeze-thaw cycles, which can compromise protein integrity .

What experimental considerations should be taken when working with lyophilized yciC protein?

When working with lyophilized yciC protein, several critical experimental considerations must be addressed:

  • Proper reconstitution: The lyophilized protein should be briefly centrifuged before opening to collect all material at the bottom of the vial . Reconstitution should be performed in deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL.

  • Storage protocol: After reconstitution, adding 5-50% glycerol and aliquoting the protein is recommended to prevent degradation during freeze-thaw cycles . Working aliquots can be stored at 4°C for up to one week, while long-term storage requires -20°C/-80°C.

  • Purity assessment: Before experimental use, purity should be verified using SDS-PAGE, with quality preparations typically showing >90% purity .

  • Buffer considerations: The protein's activity may be affected by buffer composition, so experiments should include appropriate controls to account for buffer effects on protein function.

  • Membrane protein handling: As a membrane protein, yciC may have solubility issues in aqueous solutions. Depending on the experimental design, the addition of detergents or reconstitution into lipid vesicles may be necessary to maintain native conformation and function.

How is yciC expression regulated at the transcriptional level?

The transcriptional regulation of yciC involves a sophisticated mechanism centered around zinc availability and the Zur (zinc uptake regulator) protein. Research has revealed that:

  • Zur acts as a repressor of yciC transcription in response to zinc sufficiency .

  • The yciC regulatory region contains two functional Zur boxes: a primary site (C2) overlapping a σA promoter approximately 200 bp upstream of yciC, and a secondary site (C1) near the translational start point .

  • Zur binds to both sites to mediate strong, zinc-dependent repression of yciC expression .

  • The minimal Zur operator site consists of a 9-1-9 inverted sequence motif, which is somewhat larger than that reported for other characterized Fur family members .

This dual-site regulation mechanism ensures tight control of yciC expression, allowing for robust derepression under zinc limitation conditions and efficient repression when zinc is abundant. The identification of both cis-acting elements (Zur boxes) and trans-acting factors (Zur protein) has been crucial in understanding the complete regulatory landscape of yciC expression.

What experimental approaches are most effective for studying yciC regulation?

Based on published research methodologies, the most effective experimental approaches for studying yciC regulation include:

  • Genetic approaches using transposon mutagenesis to identify regulatory elements

    • Use of mini-Tn10 insertions to create derepressed mutants

    • Plasmid rescue techniques to recover and characterize insertion sites

  • Promoter-reporter fusion assays

    • Construction of yciC promoter-cat-lacZ fusions to measure transcriptional activity

    • Analysis of expression under varying zinc concentrations

  • DNA-protein interaction studies

    • Electrophoretic mobility shift assays (EMSAs) to demonstrate Zur binding to predicted Zur boxes

    • Determination of dissociation constants (Kd) by quantifying the disappearance of free probe

  • Deletion analysis of regulatory regions

    • Generation of targeted deletions in the yciC regulatory region to assess the contribution of specific elements

    • Comparison of expression levels between wild-type and deletion constructs

These approaches should be implemented within a structured experimental design framework that includes appropriate controls and replication to ensure statistical validity of the results .

How does zinc availability affect yciC expression patterns?

Zinc availability exerts a profound influence on yciC expression patterns through the Zur-mediated regulatory system. The relationship can be characterized as follows:

Zinc StatusZur ActivityyciC ExpressionPhysiological Response
SufficientActive (DNA-bound)RepressedConservation of cellular resources
LimitingInactive (unbound)DerepressedMobilization of alternative metal acquisition/utilization systems
DeficientInactive (unbound)Strongly derepressedActivation of metallochaperone functions

The derepression of yciC under zinc limitation conditions suggests that the protein plays a role in adapting to zinc shortage, potentially by functioning as a metallochaperone that facilitates the proper distribution of limited zinc to essential metalloproteins . The tight regulation ensures that yciC is only expressed when needed, reflecting the cell's strategy for efficient resource allocation.

What are the optimal experimental design approaches for investigating yciC function?

When investigating yciC function, researchers should consider implementing a structured experimental design rather than a traditional One Factor at a Time (OFAT) approach. The optimal experimental design should include:

  • Factorial design: This allows for the simultaneous investigation of multiple factors affecting yciC function, such as metal ion concentrations, pH, temperature, and presence of potential interacting proteins .

Design ApproachCoverage of Experimental SpaceEfficiencyAbility to Detect Interactions
OFAT (Traditional)LimitedLow (requires many experiments)Poor (misses interactions)
Factorial DesignComprehensiveHigh (fewer experiments needed)Excellent (directly measures interactions)
  • Response surface methodology: Once key factors are identified, this approach can help optimize conditions for yciC activity or determine the physiological conditions under which it functions optimally .

  • Nested experimental designs: These are particularly useful for studying hierarchical effects, such as how different genetic backgrounds might influence yciC function across various environmental conditions.

  • Control considerations: Proper experimental design must include appropriate positive and negative controls, as well as technical and biological replicates to ensure statistical validity .

Implementation of these approaches requires a minimum entry of approximately 10 experiments to achieve statistical power, but provides systematic coverage of the experimental space and efficient resource utilization .

How can researchers effectively design mutation studies to investigate yciC function?

Designing effective mutation studies to investigate yciC function requires a systematic approach:

Each of these approaches should be implemented within a structured experimental design framework that ensures systematic testing of hypotheses related to yciC function .

What methodological considerations are important when studying protein-protein interactions involving yciC?

When investigating protein-protein interactions involving yciC, researchers should consider several methodological approaches, each with specific strengths and limitations:

  • In vitro interaction studies:

    • Pull-down assays using tagged recombinant yciC

    • Surface plasmon resonance to determine binding kinetics

    • Isothermal titration calorimetry to measure thermodynamic parameters

  • In vivo interaction approaches:

    • Bacterial two-hybrid systems

    • Co-immunoprecipitation followed by mass spectrometry

    • Fluorescence resonance energy transfer (FRET) with fluorescently tagged proteins

  • Crosslinking strategies:

    • Chemical crosslinking followed by mass spectrometry to identify interaction interfaces

    • Photo-crosslinking with modified amino acids at specific positions

  • Critical controls:

    • Non-specific binding controls using unrelated proteins

    • Competition assays with unlabeled proteins

    • Verification of interactions through multiple independent methods

  • Membrane protein considerations:

    • Detergent selection critically affects membrane protein interactions

    • Native membrane environment may be required for physiologically relevant interactions

    • Consider nanodiscs or liposomes to maintain membrane environment

The experimental design should account for the membrane-associated nature of yciC, as this significantly complicates standard protein-protein interaction methodologies and may require specialized approaches to maintain protein in its native conformation .

What evidence supports yciC's proposed role as a metallochaperone?

Several lines of evidence support yciC's proposed function as a metallochaperone, though the complete picture remains to be fully elucidated:

  • Protein sequence analysis has revealed similarities between yciC and factors implicated in protein metallation reactions, suggesting a role in metal ion trafficking within the cell .

  • Genetic studies have demonstrated that yciC mutation exacerbates growth defects in zinc transporter-deficient strains under zinc limitation conditions, indicating a potential role in facilitating zinc utilization in zinc-scarce environments .

  • The tight regulation of yciC by the zinc-responsive Zur repressor places it within the zinc homeostasis network, consistent with a function in zinc trafficking or allocation .

  • The membrane association of yciC suggests it may function at the interface between different cellular compartments, potentially facilitating metal transfer across membranes or to membrane-associated proteins.

How can researchers design experiments to distinguish between different metal specificities of yciC?

Designing experiments to determine the metal specificity of yciC requires a multi-faceted approach:

  • Metal binding assays:

    • Isothermal titration calorimetry to measure binding affinities for different metals

    • Inductively coupled plasma mass spectrometry (ICP-MS) to identify metals co-purifying with yciC

    • Spectroscopic techniques (e.g., X-ray absorption spectroscopy) to characterize metal coordination

  • Competitive binding studies:

    • Measure displacement of one metal by another to establish preference hierarchies

    • Determine binding constants under different metal concentration ratios

  • Functional complementation:

    • Test whether yciC can rescue phenotypes of cells deficient in chaperones for different metals

    • Examine growth phenotypes under limitation of various metals

  • Structural studies:

    • X-ray crystallography or cryo-EM of yciC bound to different metals

    • NMR studies to identify metal-binding residues and conformational changes

  • Experimental design considerations:

    • Control for metal contamination in buffers and reagents

    • Include appropriate metal chelators as controls

    • Implement factorial experimental design to simultaneously test multiple metal ions and conditions

These approaches should be implemented within a systematic experimental framework that allows for the direct comparison of yciC's interaction with different metal ions under controlled conditions.

What are the current challenges and future directions in understanding yciC's role in bacterial metal homeostasis?

Current challenges in understanding yciC's role in bacterial metal homeostasis include:

  • Technical limitations:

    • Difficulty in maintaining membrane protein solubility and activity during purification

    • Challenges in directly measuring metallochaperone activity in vitro

    • Complexity of metal ion specificity determination in the presence of multiple metals

  • Biological complexity:

    • Redundant systems for metal homeostasis complicating phenotypic analysis

    • Cross-talk between different metal regulatory networks

    • Environmental variation in metal availability affecting experimental outcomes

Future research directions should focus on:

  • Comprehensive characterization of yciC's metal-binding properties:

    • Identification of specific metal-binding residues through systematic mutagenesis

    • Determination of metal binding affinities under physiologically relevant conditions

    • Elucidation of the three-dimensional structure with bound metals

  • Identification of yciC's protein partners:

    • Systematic screening for interacting proteins using approaches like BioID

    • Validation of interactions through multiple complementary techniques

    • Characterization of the functional consequences of these interactions

  • Systems-level understanding:

    • Integration of yciC function within the broader context of cellular metal homeostasis

    • Global analysis of the effects of yciC deletion/overexpression on the metalloproteome

    • Comparative studies across different bacterial species to identify conserved functions

  • Translational applications:

    • Exploration of yciC as a potential antimicrobial target

    • Investigation of yciC's role in bacterial virulence and host-pathogen interactions

Addressing these challenges will require innovative experimental approaches and integration of data across multiple levels of analysis, from atomic-resolution structures to systems-level phenotypes.

What statistical approaches are most appropriate for analyzing yciC expression data?

  • For quantitative PCR data:

    • Normalization to multiple reference genes is essential for accurate quantification

    • The 2^(-ΔΔCt) method with appropriate validation of amplification efficiencies

    • ANOVA or mixed-effects models for comparing expression across multiple conditions

  • For reporter fusion assays:

    • Linear or non-linear regression models to characterize dose-response relationships

    • Transformation of data if necessary to meet assumptions of normality

    • Analysis of variance to compare responses across different genetic backgrounds

  • For high-throughput expression data:

    • Appropriate normalization methods specific to the platform used

    • Multiple testing correction to control false discovery rate

    • Principal component analysis or clustering to identify patterns across conditions

  • Experimental design considerations:

    • Power analysis to determine appropriate sample sizes

    • Randomization of samples to minimize batch effects

    • Inclusion of both technical and biological replicates

When designing experiments to study yciC expression, researchers should adopt structured experimental design approaches rather than one-factor-at-a-time methods to efficiently explore the experimental space and identify potential interactions between factors .

How should researchers approach contradictory data in yciC functional studies?

When encountering contradictory data in yciC functional studies, researchers should implement a systematic approach to resolve discrepancies:

  • Methodological assessment:

    • Compare experimental conditions, including expression systems, tags, and purification methods

    • Evaluate reagent quality, particularly metal salt purity and contamination

    • Assess buffer compositions, especially chelating agents and reducing conditions

  • Technical validation:

    • Repeat experiments with standardized protocols across different laboratories

    • Use alternative, complementary techniques to verify results

    • Ensure proper controls are included in all experiments

  • Statistical re-evaluation:

    • Conduct meta-analysis of available data when sufficient studies exist

    • Apply more rigorous statistical tests appropriate to the data structure

    • Consider Bayesian approaches to incorporate prior knowledge

  • Biological context consideration:

    • Assess whether contradictions might reflect genuine biological variability

    • Consider strain differences, growth conditions, and physiological states

    • Evaluate whether different experimental approaches might be measuring different aspects of yciC function

  • Experimental design strategies:

    • Implement factorial experimental designs to systematically explore condition interactions

    • Use response surface methodology to characterize complex relationships between variables

    • Develop clear hypotheses that can distinguish between competing models

What bioinformatic tools can enhance the interpretation of yciC structural and functional data?

A comprehensive suite of bioinformatic tools can significantly enhance the interpretation of yciC structural and functional data:

  • Sequence analysis tools:

    • Multiple sequence alignment programs (MUSCLE, CLUSTAL) to identify conserved residues

    • Hidden Markov Model-based tools (HMMER) to detect distant homologs

    • Motif identification software to predict functional domains

  • Structural prediction and analysis:

    • Membrane protein topology prediction (TMHMM, TOPCONS)

    • Homology modeling platforms (I-TASSER, AlphaFold)

    • Molecular dynamics simulations to study conformational changes

  • Functional annotation tools:

    • Gene ontology enrichment analysis

    • Protein-protein interaction network visualization

    • Metabolic pathway mapping and analysis

  • Comparative genomics approaches:

    • Phylogenetic analysis to trace evolutionary relationships

    • Synteny analysis to identify conserved genomic contexts

    • Correlation analysis with co-expressed genes

  • Data integration platforms:

    • Tools that integrate structural, functional, and expression data

    • Systems biology frameworks for contextualizing yciC within broader networks

    • Literature mining tools to synthesize published findings

These computational approaches complement experimental studies by generating testable hypotheses, providing context for interpretation, and revealing patterns that might not be apparent from individual experiments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.