Recombinant Escherichia coli O17:K52:H18 UPF0283 membrane protein ycjF (ycjF)

Shipped with Ice Packs
In Stock

Description

General Information

Escherichia coli ( E. coli) is a Gram-negative bacterium that inhabits the intestinal tracts of humans and animals . E. coli strains are diverse, with some being harmless commensals and others being pathogenic, causing a variety of diseases . E. coli O17:K52:H18 is a specific serotype of E. coli, with the "O," "K," and "H" referring to specific surface antigens: O antigen (lipopolysaccharide), K antigen (capsular polysaccharide), and H antigen (flagellar antigen), respectively . This particular serotype has been identified within a clonal group associated with extraintestinal infections .

YcjF is annotated as a UPF0283 membrane protein. Proteins within the UPF0283 family are of unknown function. The ycjF gene is present in E. coli O17:K52:H18 . Recombinant YcjF refers to the protein produced using recombinant DNA technology, where the ycjF gene from E. coli O17:K52:H18 is expressed in a host organism (such as E. coli) to produce a purified protein .

Characteristics

CharacteristicDescription
Product OverviewRecombinant Full Length Escherichia coli O17:K52:H18 Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF(arnF) Protein, His-Tagged, was expressed in E. coli .
Uniprot No.B7N4C9
Product TypeTransmembrane Protein
Immunogen SpeciesEscherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
AA SequenceMTEPLKPRIDFDGPLEVDQNPKFRAQQTFDENQAQNFAPATLDEAPEEEGQVEAVMDAALRPKRSLWRKMVMGGLALFGASVVGQGVQWTMNAWQTQDWVALGGCAAGALIIGAGVGSVVTEWRRLWRLRQRAHERDEARDLLHSHGTGKGRAFCEKLAQQAGIDQSHPALQRWYASIHETQNDREVVSLYAHLVQPVLDAQARREISRSAAESTLMIAVSPLALVDMAFIAWRNLRLINRIATLYGIELGYYSRLRLFKLVLLNIAFAGASELVREVGMDWMSQDLAARLSTRAAQGIGAGLLTARLGIKAMELCRPLPWIDDDKPRLGDFRRQLIGQVKETLQKGKTPSEK
Sourcein vitro E.coli expression system
Target NamesycjF
Protein NamesUPF0283 membrane protein ycjF
Expression Region1-353
Tag InfoN-terminal 10xHis-tagged
Protein Lengthfull length protein
Purity>85% (SDS-PAGE)
StorageStore at -20°C, for extended storage, conserve at -20°C or -80°C .
Storage BufferTris-based buffer, 50% glycerol, optimized for this protein

Function and Research

As a UPF0283 family protein, the specific function of YcjF in E. coli O17:K52:H18 is not well-defined. UPF0283 proteins are conserved hypothetical proteins, and further research is needed to elucidate their roles .

  • Membrane Protein Biogenesis: Research on E. coli inner membrane proteins (IMPs) has shown that their biogenesis involves a co-translational pathway, with the Sec-translocon and YidC playing crucial roles in insertion, folding, and assembly within the lipid bilayer . YcjF, being a membrane protein, may be involved in similar biogenesis processes.

  • Potential Role in Virulence: E. coli O17:K52:H18 belongs to a clonal group that exhibits virulence genotypes characteristic of extraintestinal pathogenic E. coli (ExPEC) . These ExPEC strains can cause infections outside the urinary tract. YcjF might play a role in the virulence mechanisms of this E. coli serotype.

Production and Applications

Recombinant YcjF is produced using E. coli expression systems and can be tagged with His-tags for purification .

  • Biochemical Studies: Recombinant YcjF can be used in biochemical assays to study its interactions with other proteins or molecules, potentially revealing its function in E. coli O17:K52:H18 .

  • Structural Studies: Determining the structure of YcjF could provide insights into its function and mechanism of action .

  • Antibody Development: Recombinant YcjF can be used as an antigen to generate antibodies that can be used to study its expression and localization in E. coli O17:K52:H18.

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ycjF; ECUMN_1617; UPF0283 membrane protein YcjF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Target Names
ycjF
Target Protein Sequence
MTEPLKPRIDFDGPLEVDQNPKFRAQQTFDENQAQNFAPATLDEAPEEEGQVEAVMDAAL RPKRSLWRKMVMGGLALFGASVVGQGVQWTMNAWQTQDWVALGGCAAGALIIGAGVGSVV TEWRRLWRLRQRAHERDEARDLLHSHGTGKGRAFCEKLAQQAGIDQSHPALQRWYASIHE TQNDREVVSLYAHLVQPVLDAQARREISRSAAESTLMIAVSPLALVDMAFIAWRNLRLIN RIATLYGIELGYYSRLRLFKLVLLNIAFAGASELVREVGMDWMSQDLAARLSTRAAQGIG AGLLTARLGIKAMELCRPLPWIDDDKPRLGDFRRQLIGQVKETLQKGKTPSEK
Uniprot No.

Target Background

Database Links
Protein Families
UPF0283 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.