Recombinant Escherichia coli O17:K52:H18 UPF0761 membrane protein yihY (yihY)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. If you have a specific format requirement, please specify it in your order remarks, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Our standard shipping method includes normal blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For working aliquots, store at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure all contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life of our protein products is influenced by factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Please note that the tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
yihY; ECUMN_4413; UPF0761 membrane protein YihY
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Target Names
yihY
Target Protein Sequence
MLKTIQDKARHRTRPLWAWLKLLWQRIDEDNMTTLAGNLAYVSLLSLVPLVAVVFALFAA FPMFSDVSIQLRHFIFANFLPATGDVIQRYIEQFVANSNKMTAVGACGLIVTALLLMYSI DSALNTIWRSKRARPKIYSFAVYWMILTLGPLLAGASLAISSYLLSLRWASDLNTVIDNV LRIFPLLLSWISFWLLYSIVPTIRVPNRDAIVGAFVAALLFEAGKKGFALYITMFPSYQL IYGVLAVIPILFVWVYWTWCIVLLGAEITVTLGEYRKLKQAAEQEEDDEP
Uniprot No.

Target Background

Database Links
Protein Families
UPF0761 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does the yihY protein relate to the bacterial membrane protein insertion machinery?

While no direct evidence links yihY to the bacterial holo-translocon (HTL), understanding yihY requires knowledge of how membrane proteins are processed in bacteria. The HTL complex, comprising SecYEG–SecDF–YajC–YidC, is responsible for membrane protein insertion in E. coli . As a membrane protein, yihY would likely be inserted into the membrane via this pathway.

The SecYEG translocon serves as the core channel through which membrane proteins are threaded, while YidC facilitates the lateral movement of transmembrane helices into the lipid bilayer . Given yihY's multiple predicted transmembrane domains, it likely requires the coordinated action of both SecYEG and YidC for proper insertion, similar to other multi-spanning membrane proteins.

What is known about the UPF0761 protein family?

The UPF0761 (Uncharacterized Protein Family 0761) designation indicates that yihY belongs to a family of proteins whose functions remain largely unknown. This classification is typically assigned to proteins that:

  • Have been identified through genomic sequencing

  • Show conservation across multiple bacterial species

  • Lack experimental characterization of their biochemical or cellular functions

  • Contain recognizable structural features (in this case, multiple transmembrane domains)

Members of this family, including yihY variants from different E. coli strains (O17:K52:H18 and O45:K1), show high sequence conservation, particularly in their transmembrane regions . This conservation suggests functional importance despite our limited understanding of their specific roles.

Why would researchers be interested in studying an uncharacterized protein like yihY?

Studying uncharacterized membrane proteins like yihY is valuable for several reasons:

  • Completing the functional annotation of bacterial genomes: Despite decades of research on E. coli, many proteins remain functionally uncharacterized, representing significant knowledge gaps in bacterial physiology.

  • Discovering novel physiological processes: Uncharacterized proteins often reveal previously unknown cellular pathways or regulatory mechanisms.

  • Identifying potential antimicrobial targets: Membrane proteins specific to bacteria can serve as targets for new antibiotics, particularly important given rising antimicrobial resistance.

  • Understanding membrane biology: Each membrane protein contributes to our broader understanding of how proteins integrate into and function within biological membranes.

  • Evolutionary insights: Studying conserved uncharacterized proteins can reveal evolutionary relationships and functional adaptations across bacterial species.

What are the optimal approaches for expressing recombinant yihY protein?

Successful expression of recombinant yihY requires careful consideration of several factors:

Expression system selection: While E. coli is the natural host for yihY and appears to be suitable for its recombinant expression , membrane proteins often present challenges. Consider these options:

Expression SystemAdvantagesChallenges
E. coli (BL21 or C43)Native environment, established protocols, cost-effectivePotential toxicity due to overexpression, inclusion body formation
Cell-free systemsAvoids toxicity issues, allows direct incorporation into nanodiscs or liposomesHigher cost, lower yields, potential folding issues
Yeast systemsBetter for eukaryotic membrane proteins, post-translational modificationsLower relevance for bacterial protein studies

Expression optimization strategies:

  • Use a C43 strain, which is derived from BL21 and optimized for membrane protein expression

  • Employ low induction temperatures (16-20°C) to slow expression and improve folding

  • Consider fusion tags that enhance solubility (MBP, SUMO) in addition to the His-tag

  • Use specialized vectors with tunable promoters to control expression levels

  • Supplement growth media with appropriate additives (e.g., extra lipids)

The available recombinant yihY products suggest successful expression has been achieved using E. coli as the expression host with N-terminal His-tags , indicating this approach is viable for obtaining research quantities of the protein.

What techniques are most effective for studying the structure and topology of yihY?

Given the challenges associated with membrane protein structural studies, a multi-technique approach is recommended:

  • Cysteine scanning mutagenesis: Introducing cysteine residues at different positions followed by accessibility studies can map transmembrane topology.

  • Limited proteolysis: Exposing the intact protein to proteases can identify exposed regions, helping to determine membrane orientation.

  • Cryo-electron microscopy: Increasingly useful for membrane proteins, though challenging for smaller proteins like yihY without complexation with larger partners.

  • X-ray crystallography: Challenging but possible with appropriate detergent screening and crystallization conditions. The poor electron density observed for YihE in complex structures suggests similar challenges might occur with yihY .

  • Molecular dynamics simulations: Can predict protein-lipid interactions and stable conformations within a membrane environment.

  • Crosslinking studies: Can help identify neighboring transmembrane segments and potential interaction partners.

How should researchers approach functional characterization of yihY?

Since yihY's function remains unknown, a systematic approach is necessary:

  • Phenotypic analysis of deletion mutants: Create ΔyihY strains and assess growth under various conditions (stressors, carbon sources, antibiotics) to identify conditions where yihY is important.

  • Transcriptomic and proteomic profiling: Compare wild-type and ΔyihY strains to identify genes and proteins with altered expression, potentially revealing functional pathways.

  • Protein interaction studies: Techniques such as bacterial two-hybrid assays, pull-down experiments, or in vivo crosslinking can identify interaction partners. For example, YihE (a different but similarly named protein) was found to interact with Rho using pull-down assays .

  • Membrane transport assays: If yihY functions as a transporter, assess cellular uptake of various substrates in wild-type versus mutant strains.

  • Stress response assessment: Test whether yihY is involved in membrane stress responses, similar to the Cpx stress response system in which YihE participates .

  • Localization studies: Determine where in the bacterial membrane yihY localizes, which may provide functional insights.

What is known about potential interaction partners or functional associations of yihY?

For yihY interaction studies, researchers should consider:

  • Affinity purification coupled with mass spectrometry: This could identify proteins that co-purify with tagged yihY.

  • Bacterial two-hybrid screening: Useful for detecting direct protein-protein interactions in a bacterial context.

  • In silico interaction predictions: Based on sequence homology, structural features, and genomic context.

  • Genetic approaches: Synthetic lethality or synthetic rescue experiments with other membrane protein mutants.

  • Proximity labeling: Techniques like BioID could identify proteins in close proximity to yihY in vivo.

What purification strategies are recommended for recombinant yihY?

Purifying membrane proteins like yihY presents unique challenges. A comprehensive purification strategy might include:

Extraction from membranes:

  • Isolate membrane fractions through differential centrifugation

  • Extract using appropriate detergents (start with mild detergents like DDM, LMNG, or C12E8)

  • Alternative extraction using SMA (styrene-maleic acid) copolymer to form native nanodiscs (SMALPs)

Purification steps:

  • Initial capture using Ni-NTA affinity chromatography based on the His-tag

  • Further purification by size exclusion chromatography to separate monomeric protein from aggregates

  • Optional ion exchange chromatography if additional purity is required

Buffer optimization:

  • Maintain detergent concentration above critical micelle concentration

  • Include glycerol (5-10%) for stability

  • Consider adding lipids to stabilize the protein

  • For storage, include 6% trehalose as indicated in the product information

The available recombinant protein products are supplied as lyophilized powder, suggesting this is a stable storage form . For working aliquots, store at 4°C for up to one week to avoid repeated freeze-thaw cycles that can damage membrane proteins.

How can researchers assess the proper folding and activity of purified yihY?

Given the lack of known function for yihY, assessing proper folding becomes especially important:

  • Circular dichroism (CD) spectroscopy: To verify secondary structure content, particularly the alpha-helical content expected for a membrane protein with multiple transmembrane domains.

  • Thermal shift assays: To assess protein stability and the effects of different buffer conditions.

  • Size-exclusion chromatography with multi-angle light scattering (SEC-MALS): To determine oligomeric state and homogeneity.

  • Proteoliposome reconstitution: To verify that the protein can be successfully incorporated into a lipid bilayer.

  • Limited proteolysis: Properly folded membrane proteins often show characteristic proteolytic patterns.

  • Native gel electrophoresis: To assess homogeneity and potential oligomeric states.

Without known binding partners or substrates, functional assays are challenging, but researchers might consider developing binding assays for potential ligands based on structural predictions or genomic context information.

What experimental approaches can help determine yihY's physiological role?

To elucidate yihY's function, consider these approaches:

  • Genetic context analysis: Examine the genomic neighborhood of yihY for clues about its function. Genes in the same operon often participate in related functions.

  • Comparative genomics: Identify homologs in other bacteria and assess whether their functions have been characterized.

  • Gene expression analysis: Determine conditions under which yihY expression changes, such as stress responses or growth phase transitions.

  • Phenotypic microarrays: Test growth of wild-type and ΔyihY strains under hundreds of different conditions to identify specific roles.

  • Suppressor mutation screening: Identify mutations that restore phenotypes in ΔyihY strains to gain insight into functional pathways.

  • In vivo localization: Using fluorescent protein fusions to determine subcellular localization, potentially revealing functional sites.

  • Metabolomic analysis: Compare metabolite profiles between wild-type and mutant strains to identify biochemical pathways affected by yihY deletion.

What considerations are important when designing experiments to study potential post-translational modifications of yihY?

While post-translational modifications (PTMs) are less common in bacteria than in eukaryotes, they still occur and can be functionally significant for membrane proteins:

  • Mass spectrometry approaches:

    • Top-down proteomics to analyze the intact protein

    • Bottom-up approaches with various digestion enzymes to ensure good sequence coverage

    • Targeted MS/MS to look for specific modifications

  • Specific PTMs to consider:

    • Phosphorylation (particularly if yihY interacts with kinases like YihE)

    • Methylation

    • Acetylation

    • Lipid modifications

  • Experimental design considerations:

    • Compare PTM patterns under different growth conditions

    • Use phosphatase inhibitors during purification if studying phosphorylation

    • Consider enrichment strategies for modified peptides

  • Functional validation:

    • Create site-directed mutants of modified residues

    • Assess the impact on protein localization, stability, and function

How can researchers effectively reconstitute yihY into membrane mimetics for functional studies?

For functional characterization, reconstitution into membrane mimetics is often essential:

  • Liposome reconstitution:

    • Use E. coli lipid extracts for native-like environment

    • Control protein:lipid ratios carefully

    • Verify incorporation using density gradient centrifugation

    • Consider freeze-thaw cycles to improve reconstitution efficiency

  • Nanodisc incorporation:

    • Select appropriate membrane scaffold proteins (MSPs) based on yihY size

    • Optimize detergent removal rates for proper incorporation

    • Verify monodispersity using SEC-MALS or negative-stain EM

  • Bicelle systems:

    • Useful intermediate between micelles and liposomes

    • Good for both functional and structural studies

    • Select appropriate long-chain and short-chain lipid ratios

  • SMALPs (Styrene Maleic Acid Lipid Particles):

    • Allow extraction of membrane proteins with their native lipid environment

    • Useful for studying native interactions and lipid preferences

    • Compatible with many biophysical techniques

  • Functional verification:

    • Assess protein orientation using protease accessibility

    • Measure membrane integrity using dye leakage assays

    • Set up systems to measure potential transport activity

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.