Recombinant Escherichia coli O17:K52:H18 Zinc transporter ZupT (zupT)

Shipped with Ice Packs
In Stock

Description

Protein Structure

ZupT is a 257-amino acid transmembrane protein (Uniprot ID: B7ND33) with a predicted topology of eight transmembrane domains . The recombinant version includes an N-terminal 10xHis-tag for purification and detection . Key structural features include:

  • Membrane localization: Embedded in the cytoplasmic membrane.

  • Metal-binding motifs: Histidine-rich regions critical for metal coordination .

Transport Functionality

ZupT exhibits broad metal specificity, transporting Zn²⁺, Fe²⁺, Co²⁺, and Mn²⁺ via a proton motive force-dependent mechanism . In E. coli, it operates alongside the ATP-dependent ZnuACB (ABC transporter) system to maintain zinc homeostasis .

ParameterZupTZnuACBSitABCD
Transport TypeZIP family (chemiosmotic)ABC transporter (ATP-dependent)ABC transporter (ATP-dependent)
Metal SpecificityZn²⁺, Fe²⁺, Co²⁺, Mn²⁺ Zn²⁺-specific Mn²⁺/Fe²⁺/Zn²⁺
ExpressionConstitutive Inducible (Zur-regulated)Pathogen-associated
Growth ImpactModerate Zn uptake Primary Zn uptake Minimal Zn contribution

Production Overview

ZupT is synthesized in E. coli expression systems using plasmid vectors. The full-length protein (1–257 aa) is purified via nickel-affinity chromatography due to its His-tag . Key product specifications include:

AttributeValue
Catalog No.RFL8857EF (Creative Biomart) , CSB-CF484134ENM (Cusabio)
Storage-20°C (short-term), -80°C (long-term)
Sequence CoverageFull-length (257 aa)
TagN-terminal 10xHis-tag

Research Applications

  • Metal Transport Studies: Used to investigate divalent cation uptake mechanisms .

  • Pathogenicity Models: Assessed in uropathogenic E. coli (UPEC) for zinc acquisition during infection .

  • Antimicrobial Resistance: Evaluated for metal-induced toxicity (e.g., Co²⁺ hypersensitivity) .

Zinc Homeostasis in E. coli

ZupT and ZnuACB collaborate to maintain zinc levels under limiting conditions:

  • ZnuACB Dominance: Exhibits higher Zn²⁺ affinity and is the primary transporter in E. coli K-12 and UPEC strains .

  • ZupT Complementary Role: Provides backup uptake when ZnuACB is disrupted, particularly in pathogenic strains .

In Δznu mutants, ZupT compensates minimally, but Δznu ΔzupT strains show severe growth defects in zinc-deficient media .

Pathogenic Relevance

In UPEC strain CFT073, ZupT deletion alone does not impair urinary tract infection (UTI) colonization, but combined Δznu ΔzupT mutations reduce bladder and kidney colonization by 30- and 48-fold, respectively . This highlights ZupT’s auxiliary role in pathogenic zinc acquisition.

Metal Toxicity and Resistance

Overexpression of ZupT increases sensitivity to Co²⁺ and Mn²⁺, likely due to unregulated metal influx . Conversely, cells lacking ZupT exhibit reduced oxidative stress resistance, linking zinc transport to antioxidant defense .

Comparative Analysis of Zinc Transporters

TransporterZinc Uptake EfficiencyContribution to InfectionMetal Toxicity Profile
ZnuACBHigh (ATP-dependent)Critical in UTI Zinc-specific overload
ZupTModerate (Proton motive)Auxiliary in UTI Co²⁺/Mn²⁺ hypersensitivity
SitABCDLowMinimal in UTI Fe²⁺/Mn²⁺ competition

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we can accommodate specific format requirements. Please indicate your preference when placing the order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. For precise delivery timeframes, please consult your local distributors.
Note: Our standard shipping method utilizes blue ice packs. If dry ice packaging is required, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is discouraged. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
Before opening the vial, we recommend brief centrifugation to bring the contents to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard protocol involves a final glycerol concentration of 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
zupT; ECUMN_3527; Zinc transporter ZupT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-257
Protein Length
full length protein
Species
Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Target Names
zupT
Target Protein Sequence
MSVPLILTILAGAATFIGAFLGVLGQKPSNRLLAFSLGFAAGIMLLISLMEMLPAALAAE GMSPVLGYGMFIFGLLGYFGLDRMLPHAHPQDLMQKSVQPLPKSIKRTAILLTLGISLHN FPEGIATFVTASSNLELGFGIALAVALHNIPEGLAVAGPVYAATGSKRTAILWAGISGLA EILGGVLAWLILGSMISPVVMAAIMAAVAGIMVALSVDELMPLAKEIDPNNNPSYGVLCG MSVMGFSLVLLQTAGIG
Uniprot No.

Target Background

Function
Mediates zinc uptake. May also transport other divalent cations.
Database Links
Protein Families
ZIP transporter (TC 2.A.5) family, ZupT subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is ZupT and which protein family does it belong to?

ZupT is a cytoplasmic membrane protein in Escherichia coli that functions as a divalent metal ion transporter. It is the first characterized bacterial member of the ZIP (Zrt-, Irt-like Protein) family of metal transporters, which are more commonly found in eukaryotes . The protein consists of 257 amino acids and functions primarily as a zinc uptake system in E. coli, though it has broader metal transport capabilities . Unlike many other bacterial transporters, ZupT shares structural homology with eukaryotic ZIP transporters such as those found in Arabidopsis thaliana, suggesting evolutionary conservation of this transport mechanism across domains of life .

How does ZupT differ from other zinc transporters in E. coli?

ZupT represents one component of E. coli's zinc homeostasis machinery but differs fundamentally from other zinc transporters like ZntA. While ZupT functions as an importer facilitating zinc uptake into the cell, ZntA operates as an exporter, utilizing a P-type ATPase mechanism to transport excess zinc out of the cell .

The key differences include:

FeatureZupTZntA
Transport directionImport (uptake)Export (efflux)
Protein familyZIP family transporterP-type ATPase
Energy requirementSecondary transporterATP-dependent
RegulationConstitutively expressed at low levelsInduced during zinc excess
Metal specificityBroad (Zn²⁺, Fe²⁺, Co²⁺, Mn²⁺)Primarily Zn²⁺ and Cd²⁺

This complementary system allows E. coli to maintain precise zinc homeostasis across varying environmental conditions .

What expression systems are recommended for recombinant ZupT production?

For recombinant ZupT production, E. coli expression systems are the most commonly utilized and effective approach. The full-length ZupT protein (257 amino acids) can be successfully expressed with an N-terminal His-tag in E. coli expression hosts . This homologous expression approach is advantageous since ZupT is a bacterial membrane protein, and E. coli provides the appropriate cellular machinery for proper folding and membrane insertion.

The recommended expression protocol includes:

  • Cloning the zupT gene into an expression vector with an N-terminal His-tag

  • Transforming the construct into an appropriate E. coli strain (BL21(DE3) or similar)

  • Inducing expression with IPTG when cultures reach mid-log phase

  • Harvesting cells 3-4 hours post-induction or after overnight expression at lower temperatures (16-18°C)

  • Extracting and purifying the membrane protein using detergent solubilization methods

Researchers should optimize induction conditions, as overexpression of membrane proteins can sometimes lead to toxicity or inclusion body formation .

What are the critical considerations for storing and handling purified ZupT protein?

Proper storage and handling of purified ZupT protein are crucial for maintaining its structural integrity and functional activity. The recombinant protein is typically supplied as a lyophilized powder and requires specific handling procedures :

  • Upon receipt, store the lyophilized protein at -20°C or -80°C for long-term storage

  • For reconstitution, briefly centrifuge the vial before opening to ensure all material is at the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (optimally 50%) for cryoprotection

  • Aliquot the reconstituted protein to minimize freeze-thaw cycles

  • For working stocks, store aliquots at 4°C for up to one week

  • For long-term storage, keep aliquots at -20°C or preferably -80°C

  • Avoid repeated freeze-thaw cycles as they significantly reduce protein activity

  • The protein is stable in Tris/PBS-based buffer with 6% Trehalose at pH 8.0

These storage recommendations help preserve the native conformation and functional properties of the ZupT transporter for experimental applications .

What is the substrate specificity range of ZupT transporter?

ZupT exhibits remarkably broad substrate specificity among divalent metal cation transporters. While initially characterized as a zinc transporter, research has demonstrated that ZupT can facilitate the uptake of multiple physiologically relevant divalent metal ions :

  • Zinc (Zn²⁺) - Primary physiological substrate

  • Ferrous iron (Fe²⁺) - Demonstrated through 55Fe²⁺ transport assays

  • Cobalt (Co²⁺) - Shown using 57Co²⁺ uptake experiments

  • Manganese (Mn²⁺) - Evidenced by Mn²⁺ sensitivity in ZupT-expressing cells

This broad specificity contrasts with most bacterial metal transporters that typically display high selectivity for specific ions. The ability to transport multiple essential metals suggests ZupT plays a versatile role in metal homeostasis under different environmental conditions or nutritional states .

How does ZupT transport activity compare with other metal transport systems in E. coli?

E. coli possesses multiple transport systems for essential metals, and ZupT's activity can be compared to these parallel systems:

Transport SystemPrimary SubstrateTransport MechanismRelative AffinityRegulation
ZupTZn²⁺, Fe²⁺, Co²⁺, Mn²⁺Secondary transporter (ZIP family)ModerateConstitutive, low level
FeoABCFe²⁺Energy-dependent uptakeHighIron-regulated
MntHMn²⁺, Fe²⁺Proton-dependent NRAMP homologHighMn²⁺-regulated
ZntAZn²⁺, Cd²⁺P-type ATPase effluxHighInduced by excess Zn²⁺

What mechanisms regulate ZupT expression and activity in E. coli?

Unlike many metal transporters that are tightly regulated by their substrate concentrations, ZupT appears to be constitutively expressed at relatively low levels. Studies using a Φ(zupT-lacZ) operon fusion have demonstrated that zupT gene expression does not respond significantly to changes in metal availability .

Key regulatory characteristics include:

  • Constitutive expression - zupT is expressed continuously rather than being induced by zinc deficiency

  • Low expression level - baseline expression is maintained at modest levels

  • Non-metal regulated - unlike many metal transporters, ZupT lacks strong metal-dependent transcriptional control

  • Integration with other systems - functions alongside more tightly regulated transporters to maintain metal homeostasis

This constitutive expression pattern suggests ZupT may serve as a "housekeeping" transporter that provides baseline metal uptake capability under normal conditions, while other highly regulated systems respond to specific environmental challenges .

What methods are effective for measuring ZupT-mediated metal transport in vitro?

Several experimental approaches can effectively measure ZupT-mediated metal transport activity:

  • Radioisotope Transport Assays: Utilizing radioisotopes such as 55Fe²⁺, 65Zn²⁺, or 57Co²⁺ to directly measure metal uptake into cells or membrane vesicles expressing ZupT. This approach provides the most direct evidence of transport activity .

  • Everted Membrane Vesicle Assays: Similar to those used for ZntA characterization, these assays utilize inside-out membrane vesicles to measure metal accumulation. The preparation involves:

    • Disrupting cells by French press

    • Differential centrifugation to isolate membrane fractions

    • Formation of everted vesicles

    • Incubation with radioisotope-labeled metals in the presence of energy source

    • Measurement of metal accumulation within vesicles

  • Metal Sensitivity Growth Assays: Comparing growth of ZupT-expressing strains versus control strains in the presence of various concentrations of metal ions. Hypersensitivity to specific metals (like Co²⁺ or Mn²⁺) indicates transport activity .

  • Metal Chelator Rescue Experiments: Testing whether ZupT expression can rescue growth of metal transport-deficient strains in the presence of metal chelators, which indicates functional transport capacity .

How can ZupT be functionally characterized through genetic approaches?

Functional characterization of ZupT through genetic approaches provides valuable insights into its physiological role:

These genetic approaches, particularly when combined with biochemical and physiological assays, provide comprehensive insights into ZupT function in vivo.

How can structural analysis of ZupT contribute to understanding the ZIP family transport mechanism?

Structural analysis of ZupT offers a unique opportunity to understand bacterial ZIP family transporters, which remain less characterized than their eukaryotic counterparts. Several approaches can contribute to elucidating the transport mechanism:

  • Cryo-electron Microscopy: This technique can reveal the three-dimensional structure of ZupT embedded in lipid nanodiscs or detergent micelles, providing insights into transmembrane domain organization and potential metal binding sites.

  • X-ray Crystallography: Though challenging for membrane proteins, crystallization of purified ZupT could provide atomic-level resolution of its structure, particularly if stabilized by antibody fragments or fusion proteins.

  • Site-Directed Mutagenesis: Systematic mutation of conserved residues, particularly those in transmembrane domains and the metal-binding region, can identify amino acids critical for substrate recognition and transport. This approach is especially valuable for examining:

    • Histidine residues potentially involved in metal coordination

    • Conserved transmembrane domain residues

    • Residues that differ between bacterial and eukaryotic ZIP transporters

  • Molecular Dynamics Simulations: Computational modeling of ZupT structure and metal transport can predict conformational changes during the transport cycle and guide experimental design.

Understanding the structural basis of ZupT transport would significantly advance knowledge of how ZIP family transporters function across all domains of life .

What role does ZupT play in bacterial pathogenesis and host-pathogen interactions?

ZupT's role in bacterial pathogenesis and host-pathogen interactions represents an emerging research area with significant implications:

  • Nutritional Immunity Context: During infection, host organisms sequester essential metals like zinc and iron to limit bacterial growth—a process called "nutritional immunity." ZupT may help pathogens overcome this defense by facilitating efficient metal acquisition even in metal-restricted environments.

  • Redundancy in Virulence: The broad substrate specificity of ZupT provides pathogenic E. coli strains with multiple avenues for acquiring essential metals. In strains like E. coli O17:K52:H18 (an extraintestinal pathogenic E. coli or ExPEC), this redundancy could enhance survival within diverse host environments .

  • Biofilm Formation: Metal homeostasis affects biofilm formation, a key virulence determinant. ZupT's role in maintaining intracellular zinc levels may influence biofilm development and antibiotic resistance.

  • Competitive Advantage: Within the complex microbial communities of the gut or urinary tract, ZupT might provide pathogenic E. coli with a competitive advantage in metal acquisition over commensal bacteria or other pathogens.

  • Therapeutic Target Potential: As a membrane protein involved in essential metal acquisition, ZupT represents a potential target for novel antimicrobial strategies that disrupt bacterial metal homeostasis without affecting host transporters.

Research examining zupT mutants in infection models could further elucidate its contribution to bacterial virulence and host-pathogen dynamics .

How do post-translational modifications affect ZupT function and regulation?

While less extensively studied than transcriptional regulation, post-translational modifications (PTMs) may significantly influence ZupT function and represent an important area for advanced research:

  • Phosphorylation: Potential phosphorylation sites in the cytoplasmic domains of ZupT could modulate transport activity in response to cellular energy status or environmental signals. Global phosphoproteomic studies in E. coli have identified numerous membrane transporters subject to phosphorylation-based regulation.

  • Metal-Dependent Conformational Changes: Direct binding of metal ions to regulatory sites on ZupT might induce conformational changes that allosterically regulate transport activity, creating a feedback mechanism independent of transcriptional control.

  • Protein-Protein Interactions: ZupT function may be modulated through interactions with other membrane proteins or cytoplasmic metal chaperones that influence substrate specificity or transport efficiency.

  • Membrane Microdomain Localization: Distribution of ZupT within bacterial membrane microdomains could affect its activity, with potential for dynamic redistribution in response to changing metal availability.

  • Proteolytic Regulation: Controlled proteolysis could provide a mechanism for rapidly adjusting ZupT levels in response to environmental changes, bypassing the slower transcriptional/translational control mechanisms.

Investigating these post-translational regulatory mechanisms requires advanced techniques such as mass spectrometry-based proteomics, protein crosslinking studies, and single-molecule imaging approaches to visualize ZupT dynamics in living cells.

What are common challenges in recombinant ZupT expression and how can they be addressed?

Researchers often encounter specific challenges when working with recombinant ZupT protein:

  • Low Expression Yields: As a membrane protein, ZupT can be difficult to express at high levels.

    • Solution: Optimize expression conditions by testing different E. coli strains (C41/C43 designed for membrane proteins), reducing induction temperature (16-18°C), and using controlled induction with lower IPTG concentrations (0.1-0.5 mM) .

  • Protein Aggregation and Inclusion Body Formation:

    • Solution: Co-express with molecular chaperones (GroEL/ES), use fusion partners that enhance solubility (MBP, SUMO), and optimize detergent selection for membrane extraction .

  • Loss of Activity During Purification:

    • Solution: Minimize time between cell disruption and purification, include zinc or other stabilizing metal ions in purification buffers, and maintain appropriate pH (7.5-8.0) throughout the process .

  • Tag Interference with Function:

    • Solution: Compare N-terminal and C-terminal tag positions, include longer linker sequences, or use cleavable tags that can be removed after purification .

  • Degradation During Storage:

    • Solution: Add protease inhibitors during purification, store in stabilizing buffer with 50% glycerol, and maintain proper cold chain management with minimal freeze-thaw cycles .

Implementing these strategies can significantly improve the quality and yield of functionally active ZupT protein for research applications .

How can isotope-labeled ZupT be prepared for structural and biophysical studies?

Preparation of isotope-labeled ZupT is essential for advanced structural studies using NMR spectroscopy and other biophysical techniques:

  • 15N and 13C Labeling Protocol:

    • Grow E. coli expression strain in M9 minimal media containing 15NH4Cl as the sole nitrogen source and 13C-glucose as the carbon source

    • Use a high-density fermentation approach with careful monitoring of oxygen levels

    • Induce expression at OD600 of 0.6-0.8 with reduced IPTG concentration (0.2-0.5 mM)

    • Extend expression time (16-20 hours) at lower temperature (18°C) to maximize incorporation

    • Purify using standard protocols for His-tagged proteins, with additional care to maintain structural integrity

  • Deuteration Strategies for Large Protein NMR:

    • Acclimate expression strain to D2O through sequential growth in increasing D2O concentrations

    • Use fully deuterated carbon sources and 15NH4Cl in D2O-based minimal media

    • Implement TROSY-based NMR experiments for improved spectral quality of the membrane protein

  • Selective Labeling Approaches:

    • For targeted structural studies, incorporate specific labeled amino acids (e.g., 15N-His, 13C-Leu) into otherwise unlabeled protein

    • This approach is particularly valuable for examining metal coordination sites involving histidine residues

  • Quality Control Considerations:

    • Verify incorporation rates using mass spectrometry

    • Confirm functional integrity of labeled protein through transport assays

    • Assess sample homogeneity using size-exclusion chromatography prior to structural studies

These approaches enable detailed structural investigations of ZupT's metal binding sites and conformational changes associated with transport activity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.