Recombinant Escherichia coli O45:K1 4-hydroxybenzoate octaprenyltransferase (ubiA)

Shipped with Ice Packs
In Stock

Description

Enzymatic Activity and Substrate Specificity

UbiA operates as an intramembrane prenyltransferase with the following biochemical properties:

  • Optimal pH: 7.8

  • Cofactor Requirement: Mg²⁺ or other divalent cations

  • Substrates Accepted:

    • Prenyl diphosphates: Geranyl (C10), farnesyl (C15), solanesyl (C45)

    • Kₘ Values: 254 µM (geranyl), 22 µM (farnesyl), 31 µM (solanesyl)

Biological Role in Ubiquinone Biosynthesis

UbiA is indispensable for aerobic respiration in E. coli:

  • Primary Function: Synthesizes the lipophilic side chain of ubiquinone-8, a component of the electron transport chain .

  • Regulation:

    • Catabolite-repressed by glucose via the ArcA transcription factor .

    • Anaerobic UQ biosynthesis involves the UbiUVT pathway, independent of O₂ .

Disruption of ubiA results in respiratory defects, remedied by exogenous ubiquinone or heterologous COQ2 expression .

Research Applications

Recombinant UbiA is utilized in:

  • Metabolic Studies: Investigating quinone biosynthesis and electron transport mechanisms .

  • Enzyme Engineering: Screening for inhibitors or modulators of ubiquinone production .

  • Therapeutic Targets: Studying primary ubiquinone deficiencies linked to mitochondrial disorders .

Key Research Findings

  • Functional Redundancy: UbiA’s activity can be replaced by yeast COQ2, demonstrating evolutionary conservation in prenyltransferase function .

  • O₂-Independent Pathways: UbiUVT-mediated UQ synthesis supports anaerobic nitrate respiration and uracil biosynthesis .

  • Structural Studies: Archaeal UbiA homologs reveal alternating access mechanisms for substrate flipping .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes, and we will fulfill your requirements.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice packaging is required, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by multiple factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you have a preferred tag type, please inform us, and we will prioritize its development.
Synonyms
ubiA; ECS88_4513; 4-hydroxybenzoate octaprenyltransferase; 4-HB polyprenyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Escherichia coli O45:K1 (strain S88 / ExPEC)
Target Names
ubiA
Target Protein Sequence
MEWSLTQNKLLAFHRLMRTDKPIGALLLLWPTLWALWVATPGVPQLWILAVFVAGVWLMR AAGCVVNDYADRKFDGHVKRTANRPLPSGAVTEKEARALFVVLVLISFLLVLTLNTMTIL LSIAALALAWVYPFMKRYTHLPQVVLGAAFGWSIPMAFAAVSESVPLSCWLMFLANILWA VAYDTQYAMVDRDDDVKIGIKSTAILFGQYDKLIIGIFQIGVLALMAIIGELNGLGWGYY WSILVAGALFVYQQKLIANREREACFKAFMNNNYVGLVLFLGLAMSYWHF
Uniprot No.

Target Background

Function
This enzyme catalyzes the prenylation of para-hydroxybenzoate (PHB) using an all-trans polyprenyl group. It mediates the second step in the final reaction sequence of ubiquinone-8 (UQ-8) biosynthesis. This step involves the condensation of the polyisoprenoid side chain with PHB, resulting in the formation of the first membrane-bound Q intermediate, 3-octaprenyl-4-hydroxybenzoate.
Database Links
Protein Families
UbiA prenyltransferase family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the fundamental role of 4-hydroxybenzoate octaprenyltransferase (ubiA) in E. coli metabolism?

4-hydroxybenzoate octaprenyltransferase (ubiA) is a key enzyme in the ubiquinone biosynthesis pathway in Escherichia coli. It catalyzes the transfer of an octaprenyl group to 4-hydroxybenzoate, converting it to 3-octaprenyl-4-hydroxybenzoate, which is a critical intermediate step in ubiquinone production. Ubiquinone (also known as coenzyme Q) is essential for cellular respiration as an electron carrier in the respiratory chain . Disruption of the ubiA gene results in respiration-defective phenotypes, demonstrating its crucial role in energy metabolism . The enzyme is encoded by the ubiA gene, which has been mapped to minute 79 on the E. coli chromosome .

What are the structural and biochemical characteristics of UbiA protein?

UbiA is a membrane-bound protein with a molecular mass of approximately 32kD, as determined through overexpression studies . The protein contains multiple membrane-spanning domains that anchor it to the cellular membrane. Biochemical characterization has revealed that UbiA requires magnesium ions (Mg²⁺) for optimal enzymatic activity . This requirement for Mg²⁺ is consistent with the metal-dependent nature of many prenyltransferases. The membrane association of UbiA presents significant challenges for protein purification and biochemical studies, which has limited detailed structural analyses until recent years .

How is ubiA gene expression regulated in E. coli?

Studies using ubiA-lacZ fusion systems have demonstrated that ubiA expression is subject to catabolite repression by glucose . This regulation mechanism ensures that ubiquinone biosynthesis is coordinated with cellular energy needs. The repression by glucose becomes particularly evident in arcA mutants . ArcA (aerobic respiration control) is a positively acting transcriptional regulator of oxygen-regulated genes, suggesting that ubiA expression is integrated into the broader regulatory network controlling respiratory metabolism in response to environmental conditions. This regulation ensures that ubiquinone production aligns with the cell's respiratory requirements under varying growth conditions.

What strategies can overcome the challenges in expressing and purifying recombinant UbiA protein?

Expression and purification of membrane-bound proteins like UbiA present significant challenges that have limited enzymological studies of UbiA terpene synthases (TSs) . Traditional approaches include:

  • Microsome or crude membrane fraction isolation: These methods have been used but can be labor-intensive and require ultracentrifugation equipment .

  • Alternative in vivo expression strategy: A recent breakthrough approach employs a precursor overproduction system in E. coli for biochemical characterization of membrane-associated UbiA TSs . This system bypasses the need for protein purification while still allowing functional studies.

  • Detergent solubilization optimization: Systematic testing of different detergents for membrane protein extraction can improve solubilization yields.

  • Fusion protein constructs: Creating fusion proteins with solubility-enhancing tags can improve expression and stability.

For researchers working with recombinant E. coli O45:K1 UbiA specifically, adapting these approaches with strain-specific optimization may be necessary to account for potential differences in membrane composition or protein folding requirements.

How can functional complementation assays be designed to study UbiA activity?

Functional complementation represents a powerful approach for studying UbiA activity:

  • Heterologous complementation: The respiration-defective phenotype of ubiA mutants can be complemented by expression of homologous genes from other organisms. For example, the COQ2 gene from Saccharomyces cerevisiae (encoding 4-hydroxy benzoate hexaprenyl transferase) successfully complements E. coli ubiA mutants, restoring ubiquinone-8 production . This demonstrates that COQ2 catalyzes essentially the same enzymatic reaction as UbiA, despite differences in substrate specificity.

  • Construction of complementation vectors: Design expression vectors containing either wild-type ubiA or suspected homologs under control of an inducible promoter. Transform these vectors into ubiA-disrupted strains.

  • Phenotypic assessment: Measure restoration of respiratory growth on non-fermentable carbon sources or directly quantify ubiquinone-8 production using HPLC or LC-MS methods.

  • Quantitative comparison: Compare growth rates or ubiquinone production levels between complemented strains to assess the relative efficiency of various homologs or mutant constructs.

This approach allows for evaluation of structure-function relationships without requiring purification of the membrane-bound enzyme.

What genetic engineering approaches can enhance recombinant UbiA expression and activity?

Several genetic engineering strategies can be employed to enhance recombinant UbiA expression and activity:

Genetic Engineering ApproachPotential AdvantageConsideration
Codon optimizationIncreased translation efficiencyStrain-specific optimization required
Inducible promoter systemsControlled expression timingLeaky expression may be toxic
Fusion protein constructsEnhanced stability and detectionMay affect native folding or function
Host strain engineeringBetter tolerance of membrane protein expressionMay alter native regulation
Chaperone co-expressionImproved foldingRequires additional selection markers

What are the recommended methods for measuring UbiA enzymatic activity in recombinant systems?

Measuring UbiA enzymatic activity presents challenges due to its membrane association. The following methods are recommended:

  • In vitro assay using membrane fractions:

    • Isolate membrane fractions containing UbiA from recombinant E. coli

    • Incubate with 4-hydroxybenzoate substrate and prenyl diphosphate donor

    • Include Mg²⁺ (required for optimal activity)

    • Extract reaction products and analyze by HPLC or LC-MS

  • Whole-cell bioconversion assay:

    • Supply 4-hydroxybenzoate to intact recombinant cells

    • Extract cellular lipids and analyze ubiquinone intermediates

    • Compare production in wild-type versus ubiA overexpression strains

  • Precursor overproduction system:

    • Engineer E. coli to overproduce the prenyl diphosphate substrate

    • Co-express UbiA enzyme

    • Measure conversion of 4-hydroxybenzoate to prenylated products

  • Radiolabeled substrate incorporation:

    • Use ¹⁴C-labeled 4-hydroxybenzoate

    • Measure incorporation into prenylated products

    • Quantify by scintillation counting after separation

Each method has advantages and limitations, and selection should be based on available equipment and specific research questions.

How can researchers create and validate ubiA gene knockouts for functional studies?

Creating and validating ubiA knockouts is essential for functional studies:

  • Chromosomal gene replacement:

    • Replace the ubiA gene with a selectable marker (e.g., chloramphenicol resistance gene)

    • Use homologous recombination-based methods or CRISPR-Cas9 systems

    • Screen transformants on selective media

  • Validation approaches:

    • PCR verification of gene disruption

    • Respiratory growth phenotype testing (growth deficiency on non-fermentable carbon sources)

    • Complementation testing with plasmid-expressed ubiA

    • Direct measurement of ubiquinone levels by HPLC or LC-MS

  • Physiological characterization:

    • Compare growth rates in different media

    • Measure oxygen consumption rates

    • Assess sensitivity to oxidative stress

    • Evaluate electron transport chain function

Validation is critical to ensure that observed phenotypes are specifically due to ubiA disruption rather than polar effects or secondary mutations.

What analytical methods are most effective for detecting and quantifying ubiquinone and its precursors?

Several analytical methods are effective for detecting ubiquinone and its precursors:

  • High-Performance Liquid Chromatography (HPLC):

    • Reverse-phase HPLC with UV detection at 275 nm

    • Isocratic or gradient elution with methanol/ethanol-based mobile phases

    • Allows separation of ubiquinone and various intermediates

  • Liquid Chromatography-Mass Spectrometry (LC-MS):

    • Provides both separation and structural identification

    • Can detect trace amounts of intermediates

    • Enables identification of novel or unexpected metabolites

  • Electrochemical Detection:

    • Highly sensitive for redox-active compounds like ubiquinone

    • Can differentiate between oxidized and reduced forms

  • Extraction protocols:

    • Lipid extraction using hexane/ethanol mixtures

    • Solid-phase extraction for sample cleanup

    • Specialized extraction for membrane-bound intermediates

Analytical MethodSensitivityAdvantagesLimitations
HPLC-UVModerateWidely available equipmentLimited structural information
LC-MSHighProvides structural informationExpensive equipment
HPLC-ECDVery highDetection of redox statesSpecialized equipment required
TLCLowSimple, rapid screeningLimited resolution

How should researchers address variability in UbiA expression and activity measurements?

Addressing variability in UbiA studies requires systematic approaches:

  • Standardization protocols:

    • Establish consistent growth conditions (medium composition, temperature, aeration)

    • Standardize cell harvesting at specific growth phases

    • Develop reproducible membrane preparation protocols

  • Internal controls:

    • Include enzymatic activity references in each experimental batch

    • Use constitutively expressed membrane proteins as loading controls

    • Implement spike-in standards for quantification

  • Statistical considerations:

    • Perform multiple biological replicates (minimum n=3)

    • Apply appropriate statistical tests for data validation

    • Report variability measures (standard deviation, confidence intervals)

  • Normalization strategies:

    • Normalize to total membrane protein

    • Consider activity per cell or per unit of biomass

    • Account for differences in protein expression levels

Researchers should explicitly report all normalization procedures and control measures to facilitate reproduction of results across laboratories.

What factors affect substrate specificity of UbiA, and how can they be experimentally determined?

UbiA substrate specificity is influenced by several factors that can be experimentally investigated:

  • Prenyl donor chain length preferences:

    • Test various prenyl diphosphates (C10, C15, C20, C30, C40)

    • Measure relative reaction rates with each substrate

    • Identify structural determinants using site-directed mutagenesis

  • Aromatic substrate accommodation:

    • Examine activity with modified 4-hydroxybenzoate derivatives

    • Assess competition between different substrates

    • Determine kinetic parameters (Km, Vmax) for each substrate

  • Homolog comparison approaches:

    • Compare E. coli UbiA with homologs from other organisms

    • The functional complementation of E. coli ubiA mutants by S. cerevisiae COQ2 suggests broad substrate specificity, as COQ2 normally utilizes hexaprenyl diphosphate rather than octaprenyl diphosphate

    • Create chimeric proteins to identify specificity-determining regions

  • Computational methods:

    • Homology modeling based on related structures

    • Molecular docking simulations with various substrates

    • Identification of conserved substrate-binding residues

Understanding these specificity determinants can facilitate protein engineering for biotechnological applications or provide insights into evolutionary relationships among prenyl transferases.

How can researchers distinguish between direct and indirect effects when studying UbiA function in cellular contexts?

Distinguishing direct from indirect effects requires rigorous experimental design:

  • Complementation controls:

    • Express catalytically inactive UbiA mutants

    • Compare phenotypes with complete knockouts

    • Use heterologous complementation from distantly related organisms

  • Targeted metabolite analysis:

    • Measure immediate substrates and products of UbiA

    • Track metabolic flux through the ubiquinone pathway

    • Identify potential metabolic bottlenecks

  • Time-course experiments:

    • Monitor acute versus chronic effects of UbiA disruption

    • Establish temporal relationships between metabolic changes

    • Identify primary versus secondary adaptations

  • Integration with systems biology:

    • Combine proteomics, transcriptomics, and metabolomics data

    • Map changes to known regulatory networks

    • Model metabolic flux alterations

This systematic approach enables researchers to confidently attribute observed phenotypes to specific aspects of UbiA function rather than to general metabolic disruption or compensatory adaptations.

What are the emerging technologies for studying membrane-bound enzymes like UbiA?

Recent technological advances are transforming research on membrane proteins like UbiA:

  • Alternative expression systems:

    • Cell-free membrane protein expression systems

    • Nanodiscs for stabilization of purified membrane proteins

    • Precursor overproduction systems for in vivo characterization

  • Structural biology techniques:

    • Cryo-electron microscopy for membrane protein structures

    • Solid-state NMR for membrane-embedded proteins

    • X-ray free-electron laser crystallography

  • Single-molecule approaches:

    • Fluorescence resonance energy transfer (FRET) to study conformational changes

    • Single-molecule enzymology in reconstituted membrane systems

    • Super-resolution microscopy for spatial organization studies

  • Computational methods:

    • Enhanced molecular dynamics simulations for membrane proteins

    • Machine learning approaches for predicting membrane protein structures

    • Integration of experimental data with computational models

These emerging technologies are poised to overcome traditional barriers in studying membrane-bound enzymes like UbiA.

How can comparative genomics inform our understanding of UbiA function across bacterial species?

Comparative genomics provides valuable insights into UbiA evolution and function:

  • Phylogenetic analysis:

    • Trace evolutionary relationships among UbiA homologs

    • Identify conserved functional domains

    • Correlate genetic variations with ecological niches

  • Structure-function correlations:

    • Map sequence conservation onto structural models

    • Identify species-specific adaptations in substrate binding sites

    • Correlate genetic variations with biochemical differences

  • Genomic context analysis:

    • Examine co-localization with other ubiquinone biosynthesis genes

    • Identify potential regulatory elements across species

    • Discover novel pathway components through association

  • Natural variant characterization:

    • Compare UbiA from different E. coli strains including pathogenic variants

    • Test functional complementation across species boundaries

    • Investigate substrate specificity evolution

This comparative approach can reveal fundamental insights into the adaptation of ubiquinone biosynthesis across bacterial species and ecological niches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.