Recombinant Escherichia coli O45:K1 ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Functional Role in ATP Synthase

  • Proton Translocation: Subunit a interacts with the c-subunit ring (c₁₀ in E. coli) to facilitate H⁺ transport via Asp-61 residues on c-subunits . Key residues in cytoplasmic loops (e.g., Ag⁺-sensitive Cys-86, -90, -93) regulate H⁺ flux .

  • Conformational Regulation: The ε subunit’s C-terminal domain (εCTD) inhibits ATP hydrolysis by inserting into the F₁ central cavity. ATP binding displaces εCTD, enabling rotational catalysis .

Functional Mutagenesis

  • Ag⁺ Sensitivity: Residues D92C, M93C, and I171C in loops 1–2 and 3–4 show >60% inhibition of H⁺ transport upon Ag⁺ treatment, highlighting their role in proton channel integrity .

  • Crosslinking: Cysteine substitutions in loops 1–2 (e.g., S62C, V63C) and 3–4 (e.g., I171C, F174C) disrupt subunit a/c interactions, impairing ATP synthase activity .

Applications in Research

  • Antibody Production: Epitopes (e.g., E4NMTPQD10) in subunit a’s N-terminal region are used to generate monoclonal antibodies for topology mapping .

  • Drug Target Exploration: The εCTD’s unique inhibitory mechanism in bacteria (absent in mitochondria) positions it as a potential antimicrobial target .

  • Proton Transport Assays: Purified subunit a reconstituted with b and c subunits restores H⁺-translocating activity in proteoliposomes .

Comparative Insights

FeatureE. coli Subunit aMitochondrial Homolog
InhibitorεCTD autoinhibition IF₁ protein
c-Subunit Ring Sizec₁₀ c₈ (mammals)
Proton PathwayCytoplasmic loops 1–2 and 3–4 Matrix-facing helices

Challenges and Future Directions

  • Structural Resolution: Current cryo-EM maps of E. coli ATP synthase remain limited (~10–15 Å), necessitating advanced techniques for atomic-level insights .

  • Functional Redundancy: Overlapping roles of subunit a residues in H⁺ transport complicate targeted mutagenesis .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your requests whenever possible.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpB; ECS88_4160; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-271
Protein Length
full length protein
Species
Escherichia coli O45:K1 (strain S88 / ExPEC)
Target Names
atpB
Target Protein Sequence
MASENMTPQDYIGHHLNNLQLDLRTFSLVDPHNPPATFWTINIDSMFFSVVLGLLFLVLF RSVAKKATSGVPGKFQTAIELVIGFVNGSVKDMYHGKSKLIAPLALTIFVWVFLMNLMDL LPIDLLPYIAEHVLGLPALRVVPSADVNVTLSMALGVFILILFYSIKMKGIGGFTKELTL QPFNHWAFIPVNLILEGVSLLSKPVSLGLRLFGNMYAGELIFILIAGLLPWWSQWILNVP WAIFHILIITLQAFIFMVLTIVYLSMASEEH
Uniprot No.

Target Background

Function
ATP synthase subunit a (atpB) is a key component of the proton channel. It plays a direct role in the translocation of protons across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage conditions for maintaining stability of recombinant atpB protein?

For optimal stability of recombinant atpB protein, the following storage protocols are recommended:

  • Long-term storage: Store at -20°C or -80°C in aliquots to prevent repeated freeze-thaw cycles

  • Buffer composition: Tris/PBS-based buffer with 6% Trehalose, pH 8.0, with addition of 5-50% glycerol (50% being the standard recommendation)

  • Working storage: For active experiments, store working aliquots at 4°C for no more than one week

  • Reconstitution: When using lyophilized protein, reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

Importantly, repeated freeze-thaw cycles should be strictly avoided as they significantly compromise protein stability and function .

What expression systems are typically used for producing recombinant E. coli ATP synthase subunit a?

Recombinant E. coli O45:K1 ATP synthase subunit a is typically produced using E. coli expression systems. The protein coding sequence (corresponding to amino acids 1-271) is cloned into suitable expression vectors, with common approaches including:

  • Homologous expression: Using E. coli as both the source of the gene and expression host, which maintains native folding environment

  • Tag addition: Incorporation of an N-terminal His-tag to facilitate purification

  • Vector selection: Expression vectors with strong, inducible promoters (such as T7 promoter systems)

The recombinant protein is successfully expressed in E. coli as evidenced by protein yields sufficient for experimental applications . This homologous expression approach helps ensure proper folding and function compared to heterologous systems.

How does recombinant atpB interact with other subunits during ATP synthase assembly?

ATP synthase subunit a (atpB) plays a crucial role in the assembly of the functional ATP synthase complex, particularly in the formation of the stator. Current research provides key insights into this assembly process:

  • Subunit interaction order: The alpha subunit must first complex with other F₁ subunits before the delta subunit can bind to its N-terminal region

  • N-terminal accessibility: In isolated alpha subunit, the N-terminal 1-22 residue region appears to be sequestered, preventing interaction with delta subunit

  • Conformational changes: Beta subunit binding to alpha likely triggers release of the N-terminal region, making it accessible for delta binding

  • Stoichiometric control: This sequential assembly process explains the 1:3 delta:alpha stoichiometry observed in the F₁ sector of ATP synthase

These findings suggest that proper ATP synthase assembly follows a specific pathway where conformational changes in one subunit prepare binding sites for subsequent subunits, ensuring correct stoichiometry and function .

What methodological approaches can be used to study atpB function in context of the ATP energy cycle?

To investigate atpB function within the ATP energy cycle, researchers can employ several methodological approaches:

  • Genome Editing Techniques:

    • CRISPR-based techniques for E. coli gene editing

    • MUCICAT technology for marker-free, multi-site, and multi-copy genome editing

    • Strategic insertion of genes at specific genomic locations (IS186, 8array, or IS1 sites) to control expression levels

  • Functional Assays:

    • ATP-driven proton pumping measurements to assess functional reconstitution

    • F₁-subunit dissociation/reassociation experiments to evaluate complex formation

    • Trypsin cleavage susceptibility assays to examine conformational states

  • Promoter Competition Analysis:

    • Analysis of expression levels based on genomic position

    • Comparison of genomic expression versus plasmid-based expression

    • Evaluation of copy number effects on protein expression levels

These methods can be combined to understand atpB's role in maintaining ATP energy cycles and to develop systems with improved efficiency for ATP-dependent reactions .

What are the key considerations when using recombinant atpB in reconstitution experiments?

When using recombinant atpB in reconstitution experiments, researchers should consider several critical factors:

  • Protein Quality Assessment:

    • Verify purity (>90% by SDS-PAGE)

    • Confirm proper folding through functional assays

    • Validate complete amino acid sequence and absence of truncations

  • Reconstitution Protocol Optimization:

    • Buffer selection: Tris-based buffers with specific pH (typically 8.0)

    • Protein concentration: Recommended range of 0.1-1.0 mg/mL

    • Stabilizing agents: Addition of glycerol (5-50%) to maintain stability

  • Functional Verification Methods:

    • Nucleotide binding assays to confirm binding competence

    • Complex formation assessment with other ATP synthase subunits

    • ATP-driven proton pumping assays to verify functional reconstitution

  • Storage and Handling:

    • Proper aliquoting to avoid freeze-thaw cycles

    • Centrifugation of vials prior to opening

    • Short-term storage of working solutions at 4°C (≤1 week)

Experience shows that properly reconstituted atpB can successfully integrate with other F₁ subunits to form functional complexes capable of binding to F₁-depleted membranes and restoring ATP-driven proton pumping .

How does E. coli atpB structure compare to its mitochondrial counterpart?

Comparative analysis of E. coli atpB and its mitochondrial counterpart reveals important structural and functional similarities despite evolutionary divergence:

  • Stator Structure:

    • In mitochondrial ATP synthase, the subunit corresponding to E. coli δ is called "OSCP" (Oligomycin Sensitivity Conferring Protein)

    • OSCP has been found to have similar structure to E. coli δ subunit

    • Both interact with the N-terminal region of the α subunit

  • Binding Interactions:

    • Parallel experiments confirmed that OSCP binds to the N-terminal region of mitochondrial α subunit

    • The structural model of interaction appears similar between both systems

    • This conservation suggests fundamental importance of this interaction

  • Divergent Features:

    • Despite similarities in this specific interaction, mitochondrial and bacterial ATP synthases show "remarkably different" stator structures and subunit compositions

    • These differences reflect evolutionary adaptation while preserving core functional mechanisms

This comparative understanding helps researchers translate findings between bacterial and mitochondrial systems, aiding in broader understanding of ATP synthase function across domains of life .

What experimental approaches can determine the impact of His-tag placement on atpB function?

To systematically assess the impact of His-tag placement on atpB function, researchers can implement the following experimental strategy:

  • Construct Development:

    • Generate multiple constructs with His-tags at different positions (N-terminal, C-terminal, or internal)

    • Create tag-free version as control

    • Consider tag length variations (6×His vs. 10×His)

  • Functional Assays:

    • ATP hydrolysis activity measurement

    • Proton pumping efficiency determination

    • Complex assembly assessment via protein-protein interaction studies

    • Membrane integration analysis

  • Structural Analysis:

    • Circular dichroism to assess secondary structure changes

    • Limited proteolysis to evaluate conformational alterations

    • Thermal stability measurements to detect stabilization/destabilization effects

  • Comparative Data Table:

Construct TypeATP Hydrolysis ActivityProton PumpingComplex AssemblyMembrane Integration
Tag-free (wild-type)Baseline (100%)Baseline (100%)CompleteNormal
N-terminal His~95%~90%Slightly affectedNormal
C-terminal His~97%~95%NormalNormal
Internal His (position X)VariableVariableVariableVariable

Based on available research, both N-terminal and C-terminal His-tagged versions of ATP synthase subunits appear to maintain functionality, with reported activity levels close to wild-type . The C-terminal 6-His tag on the alpha subunit has been specifically demonstrated to support full reconstitution of ATPase activity and restoration of ATP-driven proton pumping .

What methods can be employed to study the role of atpB in proton translocation?

Studying the role of atpB in proton translocation requires specialized techniques that can probe both structural and functional aspects:

  • Site-Directed Mutagenesis Approaches:

    • Target conserved residues in transmembrane segments

    • Create alanine-scanning mutants to identify critical amino acids

    • Engineer specific mutations based on sequence conservation analysis

  • Biophysical Techniques:

    • Fluorescence-based proton flux assays using pH-sensitive probes

    • Membrane potential measurements using voltage-sensitive dyes

    • Spectroscopic methods to detect conformational changes

  • Reconstitution Systems:

    • Liposome reconstitution with purified components

    • Nanodiscs for stabilized membrane protein studies

    • F₁-depleted membrane vesicle complementation experiments

  • Advanced Imaging:

    • Cryo-electron microscopy to visualize different conformational states

    • FRET-based approaches to monitor subunit movements during catalysis

    • High-speed atomic force microscopy for dynamic structural changes

Importantly, research has demonstrated that properly reconstituted ATP synthase complexes containing recombinant subunits can successfully restore ATP-driven proton pumping, providing a powerful system for studying the mechanistic role of atpB in proton translocation .

How can the cyclic ATP regeneration system be optimized using recombinant ATP synthase components?

Optimizing cyclic ATP regeneration systems using recombinant ATP synthase components involves several strategic approaches:

  • Gene Identification and Expression:

    • Identification of key genes in the ATP synthesis pathway

    • Expression of polyphosphate kinase (ppk) gene for completing cyclic reactions

    • Strategic genomic positioning for optimal expression levels

  • Genomic Integration Optimization:

    • Insertion site selection affects expression (difficulty order: IS186 < 8array < IS186 + 8array < IS1)

    • Single genome insertion can achieve plasmid-level expression

    • Copy number optimization based on specific application requirements

  • Expression Level Considerations:

    • Promoter competition analysis for maximizing expression

    • Balance between protein expression and metabolic burden

    • Expression levels are not necessarily linearly correlated with gene copy number

  • Reconstitution Parameters:

    • Optimize buffer conditions (pH, ionic strength)

    • Fine-tune protein concentrations for maximizing activity

    • Add stabilizing agents to enhance long-term functionality

Research indicates that strategic genomic insertion of ATP synthase components can achieve expression levels comparable to plasmid-based systems while maintaining greater stability. This approach is particularly valuable for applications requiring sustained ATP regeneration without selection pressure .

What are the methodological challenges in assessing protein-protein interactions involving membrane proteins like atpB?

Assessing protein-protein interactions involving membrane proteins such as atpB presents several methodological challenges that researchers must address:

  • Extraction and Solubilization:

    • Selection of appropriate detergents that maintain native interactions

    • Balancing solubilization efficiency with preservation of protein structure

    • Development of detergent-free systems (nanodiscs, amphipols)

  • Interaction Analysis Techniques:

    • Adaptation of traditional methods for membrane environment:

      • Co-immunoprecipitation with membrane-specific protocols

      • Surface plasmon resonance with modified sensor chips

      • Microscale thermophoresis in detergent-containing buffers

  • Functional Verification Approaches:

    • Quantitative fluorimetric binding assays

    • F₁-subunit dissociation/reassociation experiments

    • Trypsin susceptibility assays to detect conformational changes

  • Artifactual Interactions Control:

    • Distinguishing specific from non-specific hydrophobic interactions

    • Controlling for detergent-mediated effects

    • Validation with multiple complementary techniques

Research has demonstrated that interactions between ATP synthase subunits can be successfully studied using reassociation experiments followed by functional assays. For example, studies have shown that purified alpha subunit successfully reassociates with other F₁ subunits to form complexes with full ATPase activity, which can bind to F₁-depleted membranes and restore ATP-driven proton pumping .

How might CRISPR-based techniques advance research on ATP synthase assembly and function?

CRISPR-based techniques offer transformative potential for advancing ATP synthase research through precise genetic manipulation:

  • Marker-Free Genome Editing:

    • Development of rapid, marker-free, multi-site genome editing systems

    • Creation of multiple mutations in ATP synthase genes without antibiotic selection

    • Sequential editing to study cumulative effects of multiple modifications

  • Precision Engineering Applications:

    • Site-specific incorporation of fluorescent tags for in vivo visualization

    • Introduction of specific mutations to probe structure-function relationships

    • Creation of chimeric proteins to investigate subunit compatibility across species

  • High-Throughput Approaches:

    • CRISPR library screening to identify residues critical for assembly and function

    • Multiplex editing to create variant populations for directed evolution

    • Systematic domain swapping to map functional regions

  • Methodological Considerations:

    • Overcoming the high mortality rate associated with single-use CRISPR-Cas9 in E. coli

    • Implementing emerging CRISPR-associated transposase (CAST) systems

    • Utilizing MUCICAT technology for multi-copy genome editing

Recent research has highlighted the development of systems for rapid, marker-free, multi-site, and multi-copy genome editing in E. coli, which will significantly advance synthetic biology approaches to studying and engineering ATP synthase systems .

What potential applications exist for engineered atpB variants in synthetic biology?

Engineered atpB variants offer diverse applications in synthetic biology, with several promising directions:

  • Enhanced Bioenergetic Systems:

    • Creation of ATP synthase variants with improved efficiency

    • Development of systems with altered ion specificity (H⁺ vs. Na⁺)

    • Engineering pH-tolerant variants for extreme environmental applications

  • Biosensing Applications:

    • Development of ATP synthase-based sensors for proton gradients

    • Creation of reporter systems for membrane potential fluctuations

    • Design of whole-cell biosensors for environmental monitoring

  • Biofuel Production:

    • Engineering reversed ATP synthase function for ATP-driven proton pumping

    • Integration with light-harvesting systems for artificial photosynthesis

    • Coupling with other metabolic pathways for biofuel production

  • Therapeutic Applications:

    • Development of bacterial ATP synthase inhibitors as antimicrobials

    • Creation of model systems to study mitochondrial diseases

    • Exploration of ATP synthase as drug delivery target

These applications build upon fundamental research demonstrating that modifications to ATP synthase components can alter functionality while maintaining basic catalytic activity. For example, research has shown that strategic genomic insertion of ATP cycle-related genes can achieve expression levels comparable to plasmid systems, providing stable platforms for synthetic biology applications .

What are common pitfalls in recombinant atpB expression and purification, and how can they be addressed?

Researchers commonly encounter several challenges when expressing and purifying recombinant atpB. Here are effective troubleshooting approaches:

  • Low Expression Yields:

    • Problem: Membrane protein toxicity during overexpression

    • Solutions:

      • Utilize tightly controlled induction systems

      • Lower induction temperature (16-25°C instead of 37°C)

      • Consider alternative E. coli strains (C41/C43) specialized for membrane proteins

      • Strategic genomic insertion at optimal sites (IS186 positions)

  • Protein Misfolding:

    • Problem: Improper membrane integration leading to aggregation

    • Solutions:

      • Co-express with chaperones

      • Optimize expression rate through reduced inducer concentration

      • Use fusion partners to enhance solubility

      • Implement slow induction protocols

  • Purification Challenges:

    • Problem: Detergent interference with His-tag binding

    • Solutions:

      • Screen multiple detergent types and concentrations

      • Adjust imidazole concentrations in binding and washing steps

      • Consider alternative purification approaches (ion exchange, size exclusion)

      • Implement two-step purification protocols

  • Protein Instability:

    • Problem: Rapid degradation after purification

    • Solutions:

      • Add protease inhibitors throughout purification

      • Maintain low temperature during all steps

      • Include glycerol (5-50%) and trehalose (6%) in storage buffers

      • Aliquot and flash-freeze immediately after purification

Research indicates that proper handling of recombinant atpB is critical, with specific recommendations including reconstitution in deionized sterile water to 0.1-1.0 mg/mL concentration and addition of glycerol for long-term storage at -20°C/-80°C .

How can researchers verify the functional integrity of purified recombinant atpB?

Verifying functional integrity of purified recombinant atpB requires a multi-faceted approach combining biochemical, biophysical, and functional assessments:

  • Structural Integrity Assays:

    • Circular dichroism to confirm secondary structure

    • Thermal shift assays to determine stability

    • Limited proteolysis to assess proper folding

    • Size exclusion chromatography to verify monomeric state

  • Binding Capability Assessment:

    • Nucleotide binding assays

    • Interaction studies with other ATP synthase subunits

    • Co-precipitation experiments with binding partners

  • Functional Reconstitution Tests:

    • F₁-subunit reassociation experiments

    • Binding assays with F₁-depleted membranes

    • ATP-driven proton pumping restoration

    • ATPase activity measurements of reconstituted complexes

  • Success Indicators:

    • Complete N-terminal sequence

    • Support for full reconstitution of ATPase activity

    • Restoration of ATP-driven proton pumping in reconstituted systems

    • Normal interaction between stator delta subunit and N-terminal region when complexed with other subunits

Research has demonstrated that properly purified recombinant ATP synthase subunits can successfully support complex reconstitution with restoration of functional activities, providing a benchmark for quality assessment .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.