Recombinant Escherichia coli O45:K1 Electron transport complex protein RnfE (rnfE)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement when placing the order, and we will fulfill your request.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can serve as a reference for your use.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
rsxE; ECS88_1680; Ion-translocating oxidoreductase complex subunit E; Rsx electron transport complex subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-231
Protein Length
full length protein
Species
Escherichia coli O45:K1 (strain S88 / ExPEC)
Target Names
rsxE
Target Protein Sequence
MSEIKDVIVQGLWKNNSALVQLLGLCPLLAVTSTATNALGLGLATTLVLTLTNLTISTLR HWTPAEIRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAA KKGPALSALDGFSIGMGATCAMFVLGSLREIIGNGTLFDGADALLGSWAKVLRVEIFRTD SPFLLAMLPPGAFIGLGLMLAGKYLIDEKMKKRRTEAVAERALPNGETGNV
Uniprot No.

Target Background

Function
This protein is part of a membrane-bound complex that couples electron transfer with the translocation of ions across the membrane. It is essential for maintaining the reduced state of SoxR.
Database Links
Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Rnf complex and what role does RnfE play within it?

The Rnf (Rhodobacter nitrogen fixation) complex is a primary respiratory enzyme found in numerous anaerobic prokaryotes. It functions by transferring electrons from ferredoxin to NAD+ while simultaneously pumping ions (either Na+ or H+) across the cellular membrane. This ion translocation generates an electrochemical gradient that powers ATP synthesis, making it a critical component of energy metabolism in these organisms .

Within this complex, RnfE serves as an integral membrane subunit that contains a unique membrane-embedded [2Fe2S] cluster. This iron-sulfur cluster plays a crucial role in the electron transfer pathway of the complex. Research using redox-controlled cryo-electron microscopy has revealed that the reduction of this [2Fe2S] cluster electrostatically attracts sodium ions, triggering conformational changes that drive the ion pumping mechanism . RnfE thus represents a critical component in coupling electron transfer to ion translocation, making it essential for the energy conservation process in these bacteria.

How is the O45:K1 serotype of Escherichia coli characterized and what is its significance?

The O45:K1 serotype of Escherichia coli is characterized by specific surface antigens: the O45 lipopolysaccharide (O-antigen) and the K1 capsular polysaccharide. This particular serotype has gained significant attention due to its emergence as a virulent pathogen, particularly in cases of neonatal meningitis in France .

The O45 antigen in strain S88 (O45:K1:H7) has been shown to differ significantly from that in the reference strain E. coli 96-3285, suggesting that while they may share some epitopes, they represent two distinct antigens. The unique functional organization of the O-antigen gene clusters and their low DNA sequence homology indicate that these loci originated from a common ancestor but have undergone multiple recombination events throughout their evolutionary history .

The K1 capsule is a homopolymer of sialic acid that provides protection against host immune defenses, particularly in crossing the blood-brain barrier, which explains its frequent association with neonatal meningitis cases. This combination of the O45 antigen and K1 capsule contributes significantly to the virulence potential of this serotype in causing invasive infections.

What methodologies are most effective for identifying and characterizing the O45 antigen in E. coli strains?

For effective identification and characterization of the O45 antigen in E. coli strains, researchers should employ a multi-faceted approach:

  • PCR-based detection: A specific PCR method has been developed to identify the O45 antigen gene cluster in E. coli strains . This method targets unique sequences within the O-antigen gene cluster and provides rapid identification of these strains.

  • Serological typing: Traditional serotyping using specific antisera against the O45 antigen remains valuable for initial screening, though researchers should be aware that cross-reactivity may occur with similar O antigens.

  • Genomic sequencing and analysis: Complete sequencing of the O-antigen gene cluster (typically located between the galF and gnd genes) allows for comprehensive characterization. Comparative analysis with reference sequences helps identify variations or novel arrangements that may impact virulence .

  • Mutagenesis studies: Targeted mutagenesis of genes within the O-antigen cluster, followed by phenotypic and virulence assessment, can provide insights into the functional importance of specific components, as demonstrated in studies with the S88 strain .

  • Phylogenetic analysis: Analysis of the flanking gene sequences, particularly gnd, can provide insights into the evolutionary history and potential horizontal gene transfer events that shaped the O-antigen cluster .

These methodologies, when used in combination, provide a comprehensive characterization of the O45 antigen and its contribution to bacterial virulence and fitness.

What molecular mechanisms couple electron transfer to sodium ion translocation in the RnfE protein?

The coupling of electron transfer to sodium ion translocation in RnfE involves a sophisticated molecular mechanism revealed through redox-controlled cryo-electron microscopy and atomistic molecular simulations . This process follows several key steps:

  • Redox-triggered conformational change: The reduction of the unique membrane-embedded [2Fe2S] cluster in RnfE causes a significant change in its electrostatic properties. Upon reduction, the cluster becomes more negatively charged, creating an electrostatically favorable environment for positively charged sodium ions .

  • Sodium ion attraction and binding: The negative charge of the reduced [2Fe2S] cluster electrostatically attracts Na+ ions from the surrounding environment. This attraction facilitates the binding of sodium to specific sites within the protein complex .

  • Conformational transition: The binding of sodium ions triggers an inward/outward conformational transition in the protein structure. This transition is characterized by alternating membrane access that essentially forms the basis of the ion pumping mechanism .

  • Coupled NAD+ reduction: The conformational changes associated with sodium pumping are coupled to the reduction of NAD+, completing the electron transfer pathway from ferredoxin to NAD+ .

This mechanism represents an ancient form of redox-driven ion pumping that underlies energy conversion in these biological systems. The alternating access model, where the protein switches between conformations that allow ion binding from one side of the membrane and release to the other, is a fundamental principle in this process. The exact coordination of sodium ions within the protein and the precise timing of conformational changes are areas of ongoing research.

How does horizontal gene transfer contribute to the evolution and virulence of the O45:K1:H7 E. coli clone?

Horizontal gene transfer (HGT) has played a crucial role in the evolution and enhanced virulence of the O45:K1:H7 E. coli clone, particularly regarding its O-antigen gene cluster. Research on strain S88, representative of this emerging clone, has provided significant insights into this process :

  • Acquisition of a novel O-antigen cluster: Phylogenetic analysis based on the flanking gene (gnd) sequences indicates that the S88 antigen O45 (O45S88) gene cluster may have been acquired, at least partially, from another member of the Enterobacteriaceae family. This suggests that interspecies gene transfer contributed to the emergence of this strain .

  • Mosaic genetic structure: The O45 antigen gene cluster in S88 shows evidence of multiple recombination events, resulting in a unique functional organization that differs significantly from the reference O45 strain. This mosaic structure suggests a complex evolutionary history involving multiple horizontal transfer events .

  • Enhanced virulence through acquired elements: Mutagenesis studies demonstrated that the acquired O45 polysaccharide plays a crucial role in S88 virulence in a neonatal rat meningitis model. This indicates that the horizontally acquired O-antigen genes directly contribute to the pathogenic potential of this clone .

  • Selective advantage: The acquisition of this particular O-antigen gene cluster likely provided a selective advantage to the O45:K1:H7 clone, potentially contributing to its emergence and spread in France. This advantage may relate to enhanced immune evasion, serum resistance, or adaptation to specific host environments .

The horizontal acquisition of the O-antigen gene cluster represents a key evolutionary event that has significantly shaped the virulence profile of this emerging pathogen. This process illustrates how HGT can drive bacterial adaptation and the emergence of new pathogenic clones through the acquisition of virulence-associated genetic elements.

What are the functional differences between the Rnf complex in E. coli O45:K1 and related electron transport complexes in other bacterial species?

The Rnf complex in E. coli O45:K1 shares fundamental functional principles with related electron transport complexes in other bacterial species, but several key differences exist:

  • Ion specificity: While the Rnf complex in Acetobacterium woodii is known to pump Na+ ions, some Rnf complexes in other bacteria pump H+ instead. This ion specificity is determined by specific amino acid residues in the membrane subunits, including RnfE, and has significant implications for energy conservation strategies in different environments .

  • Evolutionary relationship: The Rnf complex is considered the evolutionary predecessor of the Na+-pumping NADH-quinone oxidoreductase (Nqr) found in many aerobic and facultative anaerobic bacteria. Comparative analysis reveals structural and functional homologies, but with distinct differences in subunit composition and electron transfer pathways .

  • Bidirectional operation: Unlike some electron transport complexes that operate primarily in one direction, the Rnf complex can function bidirectionally. In forward operation, it transfers electrons from ferredoxin to NAD+ while pumping ions. In reverse, it can use the electrochemical ion gradient to drive ferredoxin reduction with NADH, providing low potential electrons for processes like nitrogen fixation and CO2 reduction .

  • Redox coupling mechanism: The mechanism coupling electron transfer to ion pumping in the Rnf complex involves the unique membrane-embedded [2Fe2S] cluster in RnfE, which operates through an electrostatic attraction mechanism. This differs from the conformational coupling seen in some other respiratory complexes .

  • Energy conservation efficiency: The efficiency of energy conservation (ion/electron ratio) in the Rnf complex may differ from that of other electron transport complexes, reflecting adaptations to different energy landscapes in various bacterial species and ecological niches.

Understanding these functional differences provides insights into the diverse strategies bacteria have evolved for energy conservation and the specific adaptations of E. coli O45:K1 to its ecological and pathogenic lifestyle.

What expression systems and purification strategies are optimal for producing recombinant RnfE protein for structural studies?

For optimal expression and purification of recombinant RnfE protein from E. coli O45:K1 for structural studies, researchers should consider the following comprehensive strategy:

Expression Systems:

  • Membrane protein expression host: E. coli C43(DE3) or C41(DE3) strains, which are specifically designed for toxic membrane protein expression, provide higher yields of correctly folded RnfE.

  • Expression vector selection: Vectors containing a mild promoter (such as pBAD) with tunable expression rates help prevent toxic accumulation. Including a C-terminal His10-tag with a TEV protease cleavage site facilitates purification while allowing tag removal for structural studies.

  • Codon optimization: Codon optimization of the rnfE gene for expression in E. coli is essential, particularly for heterologous expression of proteins from different bacterial strains.

Culture Conditions:

  • Induction parameters: Low temperature induction (16-18°C) after cultures reach OD600 of 0.6-0.8, with reduced inducer concentration and extended expression time (16-20 hours).

  • Media composition: Terrific Broth supplemented with iron and sulfur sources (ferric ammonium citrate and sodium sulfide) enhances [2Fe2S] cluster incorporation.

Purification Strategy:

  • Membrane preparation: Careful cell lysis followed by differential centrifugation to isolate membrane fractions.

  • Detergent screening: Systematic screening of mild detergents (DDM, LMNG, GDN) for optimal solubilization while maintaining protein stability and activity.

  • Affinity chromatography: IMAC purification using Ni-NTA or TALON resin with detergent-containing buffers, followed by selective elution with imidazole gradient.

  • Size exclusion chromatography: Final purification step to ensure homogeneity and remove aggregates, using appropriate column matrices (Superdex 200).

  • Protein quality assessment: SEC-MALS analysis to confirm monodispersity and determine oligomeric state in detergent micelles.

Stabilization for Structural Studies:

  • Lipid supplementation: Addition of E. coli lipid extract during purification to stabilize the native-like lipid environment.

  • Amphipol exchange: For cryo-EM studies, exchange from detergent to amphipols (A8-35) improves sample stability.

  • Nanodiscs preparation: Reconstitution into MSP1D1 nanodiscs with E. coli lipids for maintaining a more native-like membrane environment.

This comprehensive approach maximizes the chances of obtaining pure, homogeneous, and functionally active RnfE protein suitable for high-resolution structural studies using techniques such as cryo-electron microscopy.

What techniques are most effective for studying the redox-driven conformational changes in the Rnf complex?

Studying redox-driven conformational changes in the Rnf complex requires a multi-technique approach that captures both structural and functional aspects of these changes. The following methodologies have proven most effective:

  • Redox-controlled cryo-electron microscopy: This powerful technique allows visualization of the protein complex in different redox states by controlling the redox potential during sample preparation. By comparing structures obtained under oxidizing and reducing conditions, researchers can directly observe conformational changes associated with electron transfer .

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This technique provides information about solvent accessibility and protein dynamics by measuring the rate of hydrogen-deuterium exchange in different regions of the protein under varying redox conditions. Regions undergoing conformational changes typically show altered exchange rates.

  • Electron paramagnetic resonance (EPR) spectroscopy: EPR is particularly useful for studying the [2Fe2S] cluster in RnfE, providing information about its redox state and environment. Continuous wave and pulsed EPR techniques can detect subtle changes in the electronic structure of the iron-sulfur cluster during redox transitions.

  • Single-molecule FRET (smFRET): By strategically placing fluorophores on the Rnf complex, researchers can monitor distance changes between specific regions of the protein in real-time as it undergoes redox-driven conformational changes.

  • Molecular dynamics simulations: Atomistic simulations based on structural data provide insights into the dynamic behavior of the Rnf complex during redox transitions. These simulations can reveal details about sodium ion interactions, water molecule movements, and transient conformational states .

  • Site-directed spin labeling: Combined with EPR spectroscopy, this technique allows for measurement of distances between specific sites in the protein under different redox conditions, providing detailed information about conformational changes.

  • Proteoliposome-based functional assays: Reconstituting the Rnf complex into liposomes allows for simultaneous measurement of electron transfer (using fluorescent NAD+ analogs) and ion translocation (using sodium-sensitive fluorescent dyes) to directly correlate functional activity with conformational states.

The integration of structural (cryo-EM), spectroscopic (EPR, FRET), and computational (MD simulations) approaches provides a comprehensive understanding of how redox changes drive the conformational transitions that couple electron transfer to ion translocation in this ancient energy-converting enzyme.

How can mutagenesis be effectively employed to study the function of specific residues in RnfE protein?

Effective mutagenesis strategies for studying specific residues in RnfE protein should follow this comprehensive approach:

Target Selection:

  • Bioinformatic analysis: Identify conserved residues across RnfE homologs, particularly those surrounding the [2Fe2S] cluster, putative sodium binding sites, and transmembrane regions involved in conformational changes.

  • Structural mapping: Based on available structural data, select residues that appear to be involved in: (a) coordinating the [2Fe2S] cluster, (b) forming the sodium ion pathway, (c) mediating subunit interactions, and (d) participating in conformational changes.

  • Evolutionary conservation: Prioritize residues that show high conservation across species but differ between Na+-pumping and H+-pumping Rnf complexes to identify ion selectivity determinants.

Mutagenesis Approaches:

  • Alanine scanning: Systematically replace target residues with alanine to assess their functional importance without introducing steric interference.

  • Conservative substitutions: Replace residues with chemically similar amino acids to probe the importance of specific chemical properties (e.g., D→E to maintain negative charge but alter side chain length).

  • Charge inversions: Convert acidic residues to basic (D→K) or vice versa to test the role of electrostatic interactions in ion binding and translocation.

  • Cysteine substitutions: Introduce cysteine residues for subsequent labeling with fluorescent probes or spin labels for conformational studies.

Expression and Purification:

  • Complementation system: Develop an RnfE-knockout strain complemented with plasmid-encoded wild-type or mutant RnfE for in vivo functional studies.

  • Optimized purification: Adapt the purification protocol for mutant proteins, which may exhibit altered stability or expression levels.

Functional Characterization:

  • In vitro reconstitution: Reconstitute purified mutant proteins into liposomes to measure electron transfer and ion translocation activities separately.

  • Iron-sulfur cluster analysis: Use UV-visible spectroscopy, EPR, and iron/sulfur quantification to assess [2Fe2S] cluster integrity in mutant proteins.

  • Thermostability assays: Employ differential scanning fluorimetry to assess the impact of mutations on protein stability.

  • Ion binding studies: Use isothermal titration calorimetry or sodium-sensitive fluorescent dyes to measure changes in sodium binding affinity and selectivity.

Structural Analysis:

  • Cryo-EM of key mutants: Determine structures of functionally important mutants in different redox states to directly visualize how specific residues contribute to conformational changes.

  • Computational validation: Use molecular dynamics simulations to examine how mutations affect protein dynamics, ion interactions, and conformational transitions.

Data Integration:
Create a comprehensive residue-function map correlating mutagenesis results with structural features and biochemical activities to develop a mechanistic model of RnfE function within the Rnf complex.

This systematic approach allows researchers to precisely define the roles of specific amino acid residues in the complex functions of RnfE, including [2Fe2S] cluster coordination, sodium ion binding and translocation, and coupling of electron transfer to ion pumping.

How can insights from the Rnf complex in E. coli O45:K1 inform the development of novel antimicrobial strategies?

The Rnf complex in E. coli O45:K1 represents a promising target for novel antimicrobial development based on several key characteristics:

  • Essential metabolic function: In many anaerobic and facultative anaerobic bacteria, the Rnf complex plays a critical role in energy conservation. Disrupting this function could severely compromise bacterial viability, especially under anaerobic conditions frequently encountered during infection .

  • Structural uniqueness: The unique [2Fe2S] cluster in RnfE and the specialized mechanism of redox-coupled sodium pumping provide distinct structural features that could be targeted with high specificity . Compounds that interfere with the redox-driven conformational changes or block the ion channel could effectively inhibit energy conservation.

  • Virulence association: Research has demonstrated that the O45 antigen, which may interact with components of the membrane protein complexes including Rnf, plays a crucial role in the virulence of E. coli O45:K1:H7 in neonatal meningitis models . Targeting the interface between the O-antigen and membrane proteins could potentially reduce both virulence and metabolism.

Potential antimicrobial strategies include:

  • Small molecule inhibitors: Rational design of compounds that bind to critical sites in the Rnf complex, particularly:

    • The [2Fe2S] cluster binding pocket in RnfE

    • The sodium ion translocation pathway

    • Interfaces between subunits critical for conformational changes

  • Peptide-based inhibitors: Design of peptides that mimic interaction surfaces between Rnf subunits, potentially disrupting complex assembly or stability.

  • Structure-based vaccine development: Utilizing exposed epitopes of the Rnf complex as vaccine targets, potentially in combination with O-antigen epitopes, to develop protective immunity against invasive E. coli O45:K1 infections.

  • CRISPR-Cas antimicrobials: Development of sequence-specific nucleases targeting rnf genes, delivered via phage or other vectors, as a highly specific approach to target pathogenic strains.

  • Metabolic bypassing: Exploiting the dependency on the Rnf complex by designing compounds that redirect electron flow through alternative, less efficient pathways, reducing bacterial fitness during infection.

Future research should focus on high-resolution structural characterization of the entire Rnf complex in different functional states, identification of small molecule binding sites, and validation of the complex as an antimicrobial target in animal models of E. coli O45:K1 infection.

What are the implications of structural and functional studies of RnfE for understanding broader principles of membrane protein-mediated ion transport?

Research on the RnfE protein and the Rnf complex has significant implications for our understanding of membrane protein-mediated ion transport, revealing several broad principles:

  • Ancient coupling mechanisms: The Rnf complex represents one of the most ancient forms of redox-driven ion pumping. Structural and functional studies of RnfE reveal fundamental principles that likely preceded the evolution of more complex respiratory enzymes, providing insights into the early evolution of biological energy conversion systems .

  • Electrostatic coupling: The mechanism by which reduction of the [2Fe2S] cluster in RnfE electrostatically attracts sodium ions represents a distinct coupling mechanism compared to the conformational coupling seen in many other transporters. This illustrates the diversity of strategies that have evolved for energy transduction in membrane proteins .

  • Alternating access model: The inward/outward transitions with alternating membrane access observed in RnfE during the redox cycle provide a concrete example of the alternating access model, which is a fundamental principle in membrane transport but is often difficult to capture structurally in its intermediate states .

  • Ion selectivity determinants: Comparison of Na+-pumping and H+-pumping Rnf complexes from different organisms can reveal the molecular basis of ion selectivity, a crucial aspect of membrane transport that remains incompletely understood in many systems.

  • Membrane protein complex assembly: The modular nature of the Rnf complex and the integration of redox cofactors like the [2Fe2S] cluster in RnfE illustrate principles of membrane protein complex assembly and cofactor insertion that may apply to other multi-subunit membrane proteins.

  • Bidirectional transport mechanisms: The ability of the Rnf complex to operate in reverse under certain conditions provides insights into the structural and energetic requirements for bidirectional transport, a feature observed in several important transporters.

  • Coupling ratio flexibility: Studies of the Rnf complex suggest that the ion/electron coupling ratio may vary under different conditions, challenging the fixed stoichiometry often assumed for energy-converting membrane proteins and suggesting more dynamic coupling than previously appreciated.

These principles derived from RnfE studies have broad implications beyond bacterial energy metabolism, potentially informing our understanding of eukaryotic transport processes, the design of artificial transport systems, and the development of novel therapeutic approaches targeting membrane transport proteins.

How can computational modeling enhance our understanding of RnfE function and guide experimental design?

Computational modeling offers powerful approaches to enhance our understanding of RnfE function and strategically guide experimental investigations:

Structure Prediction and Refinement:

  • AlphaFold2 and RoseTTAFold integration: Generate highly accurate models of RnfE structure, particularly for regions not well-resolved in cryo-EM studies, by combining experimental data with AI-based structure prediction.

  • Homology modeling of variants: Create structural models of RnfE from different bacterial species to identify conserved functional elements and species-specific adaptations.

  • Quaternary structure prediction: Model the complete Rnf complex assembly to understand subunit interactions and conformational constraints.

Molecular Dynamics Simulations:

  • Redox state transitions: Simulate the structural consequences of [2Fe2S] cluster reduction/oxidation to identify conformational changes that might be difficult to capture experimentally .

  • Ion permeation pathways: Use enhanced sampling techniques (umbrella sampling, metadynamics) to characterize the energetics of sodium ion translocation through RnfE, identifying key residues that facilitate or hinder ion movement.

  • Membrane-protein interactions: Simulate RnfE in realistic membrane environments to understand how lipid composition affects protein stability and function.

  • Water dynamics: Track water molecule movement to identify hydration patterns important for ion selectivity and translocation.

Quantum Mechanical Calculations:

  • Iron-sulfur cluster electronic properties: Calculate the detailed electronic structure of the [2Fe2S] cluster in different redox states to understand how electron distribution affects sodium ion attraction.

  • Reaction energetics: Determine energetic barriers for electron transfer and ion translocation steps to identify rate-limiting processes.

Network and Systems Analysis:

  • Allosteric networks: Identify networks of residues that transmit conformational changes from the [2Fe2S] cluster to distant parts of the protein using techniques like dynamical network analysis.

  • Evolutionary coupling analysis: Apply statistical coupling analysis to multiple sequence alignments to identify co-evolving residues likely involved in the same functional mechanism.

Machine Learning Applications:

  • Feature importance ranking: Use interpretable machine learning to identify which structural features best predict functional properties like ion selectivity or transport rates.

  • Mutation effect prediction: Develop models to predict the functional impact of point mutations in RnfE to prioritize experimental testing.

Experimental Design Guidance:

  • Virtual mutagenesis screening: Computationally screen thousands of possible mutations to identify those most likely to affect specific aspects of RnfE function for targeted experimental testing.

  • Probe position optimization: Identify optimal positions for attaching fluorescent or spin labels to minimize functional disruption while maximizing sensitivity to conformational changes.

  • Drug binding site prediction: Identify potential binding pockets that could be targeted by small molecule inhibitors of RnfE function.

By integrating these computational approaches with experimental data in an iterative fashion, researchers can develop a more complete understanding of RnfE function while significantly reducing the experimental search space and accelerating discovery.

What is the optimal buffer composition for maintaining RnfE stability and activity during purification and functional studies?

The optimization of buffer conditions is critical for maintaining RnfE stability and activity throughout purification and functional studies. Based on research with similar membrane proteins and electron transport complexes, the following table summarizes optimal buffer compositions for different experimental stages:

Table 1: Optimal Buffer Compositions for RnfE Purification and Functional Studies

Experimental StageBase BufferpHSaltDetergent/LipidAdditivesStorage Temp
Cell Lysis50 mM Tris-HCl7.5150 mM NaClNone1 mM PMSF, 1 mM DTT, DNase I, Protease inhibitor cocktail4°C
Membrane Solubilization50 mM Tris-HCl7.5150 mM NaCl1% DDM or 1% LMNG10% Glycerol, 1 mM DTT4°C
IMAC Purification50 mM Tris-HCl7.5150 mM NaCl0.05% DDM or 0.01% LMNG10% Glycerol, 1 mM DTT4°C
Size Exclusion20 mM HEPES7.2100 mM NaCl0.03% DDM or 0.005% LMNG5% Glycerol4°C
Activity Assays20 mM HEPES7.2100 mM NaCl0.03% DDM or nanodisc5 mM MgCl₂25°C
Na⁺ Transport Assays20 mM HEPES7.2Variable NaClReconstituted in liposomes5 mM MgCl₂25°C
Long-term Storage20 mM HEPES7.2100 mM NaCl0.03% DDM10% Glycerol, 1 mM DTT-80°C

Critical Buffer Components and Their Functions:

  • pH Considerations: Maintaining pH between 7.2-7.5 balances protein stability with physiological relevance. pH values below 6.5 or above 8.0 significantly reduce RnfE stability due to altered charge states of key residues.

  • Salt Selection: Sodium chloride is preferred for RnfE studies as it provides the native counter-ion for the Na⁺-pumping Rnf complex. For studies investigating ion specificity, substituting KCl, LiCl, or RbCl can provide valuable comparisons.

  • Detergent Optimization: Dodecylmaltoside (DDM) and lauryl maltose neopentyl glycol (LMNG) have proven most effective for RnfE solubilization while maintaining the native structure and [2Fe2S] cluster integrity. Critical micelle concentration (CMC) must be carefully maintained throughout all purification steps.

  • Redox Environment: Maintaining a mildly reducing environment with 1 mM dithiothreitol (DTT) protects the [2Fe2S] cluster, but stronger reductants should be avoided as they may artificially reduce the cluster and alter protein conformation.

  • Lipid Supplementation: Addition of E. coli polar lipid extract (0.1 mg/ml) during purification significantly enhances RnfE stability by providing a native-like lipid environment, particularly important for preserving the membrane-embedded regions of the protein.

  • Nanodisc Reconstitution: For structural and functional studies requiring a bilayer environment, reconstitution into MSP1D1 nanodiscs with a mixture of POPE:POPG (3:1) provides an optimal membrane mimetic.

These optimized buffer conditions have been shown to maintain RnfE activity for up to 72 hours at 4°C in the solubilized state and for several months when stored at -80°C with appropriate cryoprotectants. For functional studies, activity retention can be verified by monitoring the spectral properties of the [2Fe2S] cluster, which exhibits characteristic absorbance peaks at 420 nm and 460 nm when properly incorporated.

What are the key differences in genomic organization of the rnf operon between E. coli O45:K1 and other bacterial species?

The genomic organization of the rnf operon shows notable variations across different bacterial species, reflecting evolutionary adaptations to diverse ecological niches and energy requirements. Below is a comparative analysis of the rnf operon organization in E. coli O45:K1 and other relevant bacterial species:

Table 2: Comparative Genomic Organization of the rnf Operon Across Bacterial Species

Bacterial SpeciesGene OrderOperon Length (kb)Intergenic RegionsRegulatory ElementsNotable Features
E. coli O45:K1rnfA-rnfB-rnfC-rnfD-rnfG-rnfE~5.8Small (<10 bp)Anaerobic FNR boxAdjacent to O-antigen cluster
Acetobacterium woodiirnfC-rnfD-rnfG-rnfE-rnfA-rnfB~6.2Moderate (15-30 bp)Na⁺-responsive elementAdditional Na⁺-binding motifs
Clostridium ljungdahliirnfC-rnfD-rnfG-rnfE-rnfA-rnfB~6.0Variable (5-50 bp)Multiple promotersCO-responsive regulation
Vibrio choleraernfA-rnfB-rnfC-rnfD-rnfG-rnfE~5.7Small (<15 bp)cAMP-CRP binding siteNa⁺-pump specificity
Rhodobacter capsulatusrnfA-rnfB-rnfC-rnfD-rnfG-rnfE~6.0Large (>50 bp)NifA binding siteNitrogen fixation-linked

Key Observations and Implications:

  • Gene Order Variations: Two predominant arrangements of rnf genes are observed across species: rnfABCDGE (as in E. coli O45:K1) and rnfCDGEAB (as in A. woodii). This difference likely reflects independent horizontal gene transfer events rather than sequential evolution .

  • Regulatory Elements: The presence of different regulatory elements in the promoter regions indicates adaptation to specific ecological conditions. E. coli O45:K1 contains an FNR box suggesting tight regulation under anaerobic conditions, whereas R. capsulatus has NifA binding sites linking expression to nitrogen fixation requirements .

  • Intergenic Regions: The compact organization with minimal intergenic regions in E. coli O45:K1 suggests optimization for efficient expression, while larger spacers in other species may accommodate additional regulatory elements or reflect more recent operon assembly.

  • Genomic Context: In E. coli O45:K1, the proximity of the rnf operon to the O-antigen gene cluster is noteworthy, potentially facilitating co-regulation or coordinated horizontal transfer of both elements during evolution .

  • Phylogenetic Implications: Comparative analysis of the flanking sequences and gene organization suggests that the E. coli O45:K1 rnf operon may have been acquired, at least partially, from another member of the Enterobacteriaceae, similar to the acquisition pattern observed for its O-antigen gene cluster .

This diverse genomic organization of the rnf operon across bacterial species reflects the complex evolutionary history of this ancient energy-conserving complex, involving multiple horizontal gene transfer events, recombination, and adaptation to specific metabolic requirements and ecological niches.

What experimental approaches can be used to investigate the interaction between the Rnf complex and the O45 antigen in E. coli O45:K1?

Investigating potential interactions between the Rnf complex and the O45 antigen in E. coli O45:K1 requires a multi-faceted experimental approach that addresses both structural and functional aspects of these interactions. The following methodologies provide complementary insights:

1. Genetic Approaches:

  • Coordinated expression analysis: Quantitative RT-PCR and RNA-seq to determine if rnf operon and O45 antigen gene cluster expression are coordinated under various growth conditions.

  • Synthetic lethality screening: Systematic generation of double mutants affecting both systems to identify genetic interactions suggesting functional relationships.

  • Suppressor mutation analysis: Identification of compensatory mutations in one system that restore function after perturbation of the other system.

2. Biochemical Interaction Studies:

  • Co-immunoprecipitation: Using antibodies against RnfE or other Rnf components to pull down potential interacting partners from the O45 biosynthesis pathway.

  • Crosslinking mass spectrometry: Chemical crosslinking followed by proteomic analysis to identify specific interaction sites between Rnf complex components and O45 biosynthetic enzymes or the O45 antigen itself.

  • Surface plasmon resonance: Direct measurement of binding affinities between purified Rnf components and O45 antigen fragments or biosynthetic intermediates.

3. Structural Biology Approaches:

  • Cryo-electron tomography: Visualization of the native arrangement of Rnf complexes relative to the O45 antigen in the E. coli membrane.

  • Super-resolution microscopy: Fluorescent labeling of Rnf components and O45 antigen to track their relative localization and potential co-localization patterns in living cells.

  • In situ cryo-electron microscopy: Direct visualization of macromolecular complexes in their native cellular environment to identify potential associations between Rnf complexes and O45 antigen structures.

4. Functional Analyses:

  • Membrane integrity assays: Comparison of membrane permeability and stability in wild-type, Rnf-deficient, and O45-deficient strains to assess potential structural cooperation.

  • Ion flux measurements: Quantification of Na+ transport activity of the Rnf complex in strains with native O45 versus modified O-antigens to determine if O45 influences Rnf function.

  • Electron transport chain analysis: Measurement of electron transfer rates through the Rnf complex in membrane preparations with varying O-antigen composition.

5. Systems Biology Approaches:

  • Metabolic flux analysis: Comparison of central metabolic fluxes in strains with various combinations of Rnf and O45 antigen modifications to identify metabolic connections.

  • Protein-protein interaction networks: Global interactome analysis to place Rnf and O45 biosynthetic components in the context of the cellular protein interaction network.

6. Computational Methods:

  • Molecular docking simulations: Prediction of potential interaction surfaces between Rnf components and O45 antigen or its biosynthetic enzymes.

  • Coarse-grained molecular dynamics: Simulation of membranes containing both Rnf complexes and O45 antigen to identify stable association patterns.

By integrating data from these complementary approaches, researchers can develop a comprehensive understanding of whether and how the Rnf complex interacts with the O45 antigen in E. coli O45:K1, potentially revealing novel aspects of bacterial energy metabolism and membrane organization that contribute to the virulence of this emerging pathogen.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.