Recombinant Escherichia coli O45:K1 Fumarate reductase subunit C (frdC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please specify it in your order; we will prioritize your request.
Synonyms
frdC; ECS88_4740; Fumarate reductase subunit C; Fumarate reductase 15 kDa hydrophobic protein; Quinol-fumarate reductase subunit C; QFR subunit C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-131
Protein Length
full length protein
Species
Escherichia coli O45:K1 (strain S88 / ExPEC)
Target Names
frdC
Target Protein Sequence
MTTKRKPYVRPMTSTWWKKLPFYRFYMLREGTAVPAVWFSIELIFGLFALKNGPEAWAGF VDFLQNPVIVIINLITLAAALLHTKTWFELAPKAANIIVKDEKMGPEPIIKSLWAVTVVA TIVILFVALYW
Uniprot No.

Target Background

Function
Two distinct, membrane-bound, FAD-containing enzymes catalyze the interconversion of fumarate and succinate: fumarate reductase (for anaerobic growth) and succinate dehydrogenase (for aerobic growth). FrdC anchors the catalytic components of the fumarate reductase complex to the inner cell membrane and binds quinones.
Database Links
Protein Families
FrdC family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Escherichia coli O45:K1 and why is frdC significant in research?

Escherichia coli O45:K1 belongs to a group of extraintestinal pathogenic E. coli strains. The K1 capsular antigen is particularly significant as it's associated with virulence in meningitis and other invasive infections. E. coli K1 strains commonly belong to the ST95 complex, with O45 being one of the serogroups associated with invasive disease . Fumarate reductase subunit C (frdC) is a membrane-anchoring protein component of the fumarate reductase complex that plays a crucial role in anaerobic respiration, allowing E. coli to use fumarate as a terminal electron acceptor when oxygen is absent. This protein is valuable for understanding bacterial adaptation to anaerobic environments and potentially as a target for antimicrobial development.

How should I design expression vectors for optimal frdC production?

Vector design for frdC expression requires careful consideration of several elements:

  • Promoter selection: Inducible promoters like T7 or XylS/Pm offer tight regulation, which is crucial for potentially toxic membrane proteins like frdC . The choice between strong (T7) and moderately strong (trc, tac) promoters depends on whether your goal is maximum yield or soluble protein.

  • Plasmid copy number (PCN): Lower copy number plasmids often yield better results for membrane proteins as they reduce metabolic burden. Data shows that increasing PCN can significantly decrease growth rates and final biomass, which directly impacts protein yield .

  • Fusion partners: Adding fusion tags that enhance solubility (such as MBP, SUMO, or Trx) may help prevent aggregation, though for membrane proteins like frdC, specific membrane-targeted fusion partners might be more appropriate.

  • Secretion signals: Including appropriate secretion signals can direct the protein to the membrane, critical for proper folding of frdC.

Each element should be optimized through experimental design approaches rather than trial-and-error methods to efficiently identify optimal conditions .

What cultivation conditions should be optimized for successful frdC expression?

Cultivation conditions significantly impact the success of membrane protein expression:

  • Temperature: Lowering the cultivation temperature (typically to 20-25°C) after induction slows protein synthesis, allowing proper folding and insertion into membranes. Studies show this can reduce growth rates by approximately 33% but dramatically improves functional protein yields .

  • Media composition: Rich media support higher biomass but defined media offer better control. For membrane proteins, supplementing with specific phospholipids can enhance proper insertion.

  • Induction parameters: Inducer concentration and timing are critical. For membrane proteins, lower inducer concentrations often yield better results. Data indicates that induction imposes greater metabolic burden than plasmid maintenance alone, especially with strong promoters .

  • Aeration conditions: Since frdC functions in anaerobic conditions naturally, manipulating oxygen levels during expression may improve native conformation.

These parameters should be systematically optimized using statistical experimental design approaches, which provide more reliable results than traditional univariant methods .

How does plasmid copy number affect metabolic burden during frdC expression?

Plasmid copy number (PCN) significantly impacts host metabolism during recombinant protein production. Research demonstrates that higher PCN correlates with decreased growth rates and reduced final biomass, particularly evident in strains with PCN > 20 . For frdC expression, this metabolic burden manifests through:

  • Carbon flux redistribution: High PCN diverts carbon resources from central metabolism to plasmid replication and maintenance, reducing energy available for growth and protein synthesis.

  • Amino acid depletion: Expression of membrane proteins places high demands on specific amino acids, potentially creating bottlenecks in translation.

  • Membrane stress: For membrane proteins like frdC, high expression levels saturate membrane insertion machinery, triggering stress responses that further reduce cellular fitness.

Studies using CapIC- and LC-MS/MS methods to profile over 60 metabolites have shown that while E. coli's central carbon metabolism is surprisingly robust against plasmid burden alone, induction of protein expression (especially with strong promoters) creates significant metabolic alterations . These findings suggest that for frdC expression, moderate copy number vectors with carefully tuned induction parameters would balance protein yield against metabolic burden.

What experimental design approaches can optimize recombinant frdC expression?

Statistical experimental design methodologies offer significant advantages over traditional trial-and-error approaches for optimizing recombinant protein expression. For frdC, multivariant analysis allows researchers to:

  • Simultaneously evaluate multiple variables: Temperature, inducer concentration, media composition, and harvest time can be assessed in a factorial design that reveals both individual effects and interactions between variables.

  • Minimize experimental runs: Fractional factorial designs maintain statistical validity while reducing required experiments, valuable when working with complex membrane proteins like frdC .

  • Quantify experimental error: This approach enables distinction between true effects and experimental noise, critical for reproducible protocols.

A successful experimental design for frdC optimization might include:

  • Response variables: Protein yield, membrane integration efficiency, enzymatic activity

  • Factors: Temperature (16-37°C), inducer concentration (0.01-1.0 mM), media composition variables

  • Design: 2^k factorial or response surface methodology

This approach has been demonstrated to increase soluble protein yields to levels as high as 250 mg/L in optimized conditions, compared to traditional approaches .

How can I manage and prevent inclusion body formation when expressing frdC?

As a membrane protein, frdC has high hydrophobicity and complex folding requirements that often lead to inclusion body formation. Advanced strategies to address this challenge include:

  • Controlled expression rates: Lowering temperature (16-25°C) and using weaker promoters or lower inducer concentrations slows translation, allowing membrane insertion machinery to cope with the protein synthesis rate.

  • Co-expression strategies: Supplementing with molecular chaperones (GroEL/ES, DnaK/J) or membrane insertion machinery components (YidC, SecYEG) can increase correct membrane integration.

  • Fusion partner optimization: For membrane proteins, specific fusion partners like Mistic (from B. subtilis) or YiaT (from E. coli) enhance membrane targeting and integration.

  • Membrane engineering: Overexpressing phospholipid biosynthesis genes expands membrane capacity to accommodate additional proteins.

  • Refolding from inclusion bodies: If prevention fails, specialized refolding methods using detergent-lipid mixed micelles can recover functional protein.

When properly implemented, these strategies can increase the yield of correctly folded membrane proteins by 5-10 fold compared to standard conditions .

How does frdC expression affect central carbon metabolism pathways in E. coli?

High-level expression of membrane proteins like frdC significantly alters E. coli's central carbon metabolism. Advanced metabolite profiling reveals:

  • TCA cycle modulation: Expression of membrane proteins often reduces TCA cycle flux, with accumulation of certain intermediates reflecting metabolic bottlenecks.

  • Glycolytic pathway adaptation: The glycolytic flux increases to compensate for energy demands of protein synthesis and membrane insertion.

  • Amino acid biosynthesis pressure: Pathways producing amino acids abundant in the target protein show increased activity but may become limiting factors.

Mass spectrometric metabolite profiling covering over 60 central carbon metabolites has demonstrated that induction of recombinant protein production creates a greater metabolic challenge than plasmid maintenance alone . For membrane proteins specifically, there is often significant upregulation of phospholipid biosynthesis pathways and stress response metabolites. These metabolic adaptations suggest potential targets for strain engineering to improve frdC expression, such as supplementation with specific metabolites or overexpression of rate-limiting enzymes in affected pathways.

What are the optimal purification strategies for maintaining frdC functionality?

Purifying membrane proteins like frdC while maintaining functionality requires specialized approaches:

  • Membrane fraction isolation: Differential centrifugation followed by density gradient separation yields purified membrane fractions containing the target protein.

  • Detergent selection: Critical for extracting membrane proteins without denaturation. For frdC, mild non-ionic detergents (DDM, LMNG) or zwitterionic detergents (LDAO) at concentrations just above their critical micelle concentration typically yield best results.

  • Affinity purification optimization: Including affinity tags positioned to avoid interference with membrane insertion (typically at the C-terminus for proteins like frdC) enables efficient purification.

  • Lipid maintenance: Maintaining a lipid-to-protein ratio of approximately 0.5-1.0 (w/w) during purification preserves native-like environment and function.

  • Activity assays: Specialized assays monitoring electron transfer capability in reconstituted systems or artificial membrane environments confirm functionality.

A typical purification workflow achieves approximately 75% homogeneity while maintaining functional activity . For structural studies requiring higher purity, additional ion exchange or size exclusion chromatography steps may be necessary, though these additional steps typically reduce yield by 15-20%.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.