Recombinant Escherichia coli O45:K1 Fumarate reductase subunit D (frdD)

Shipped with Ice Packs
In Stock

Description

Recombinant Production and Expression

Recombinant frdD is produced via heterologous expression in E. coli using plasmid-based systems. Key production parameters include:

ParameterSpecification
Expression HostE. coli (e.g., BL21(DE3) or Walker strains for toxic proteins)
TagN-terminal His-tag (for purification)
Purity>90% (SDS-PAGE validated)
Storage BufferTris-based buffer with 50% glycerol (pH 8.0)
Yield~50 µg (standard commercial offerings)

Challenges:

  • Membrane Protein Toxicity: Overexpression can disrupt host membrane integrity, necessitating optimized induction protocols .

  • Proper Folding: Requires chaperones or co-expression systems to maintain structural integrity in heterologous hosts .

Pathogenic Significance

In E. coli O45:K1, frdD is part of a genomic island enriched in virulence factors, including iron acquisition systems (e.g., aerobactin, salmochelin) and invasion proteins . Its expression may contribute to intravascular survival and blood-brain barrier penetration in meningitis .

Functional Validation

  • Membrane Association: Co-expression of frdC and frdD is essential for QFR membrane integration .

  • Substrate Specificity: frdD mutants fail to oxidize reduced quinones, disrupting anaerobic respiration .

Sequence and Bioinformatics Data

The E. coli O45:K1 frdD sequence (UniProt: B7MKV8) includes a hydrophobic stretch for membrane anchoring. A comparison with Vibrio vulnificus frdD (UniProt: Q8DCX4) highlights conserved motifs:

OrganismAA Sequence Segment (Hydrophobic Region)
E. coli O45:K1 (B7MKV8)MINPNPKRSDEPVFWGLFGAGGMWSAIIAPVMILLVGILLPLGLFPGDALSYERVLAFAQ
Vibrio vulnificus (Q8DCX4)MKPNYNVDRAPKRSDEPVWWSLFGAGGTWFAMITPVTVLVLGILVPMGVINAEALSYDRV

Future Directions

  • Therapeutic Targeting: Inhibitors of frdD-Q(P) interactions may disrupt E. coli O45:K1 pathogenesis .

  • Structural Biology: High-resolution cryo-EM studies to elucidate frdD’s role in QFR assembly.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
frdD; ECS88_4739; Fumarate reductase subunit D; Fumarate reductase 13 kDa hydrophobic protein; Quinol-fumarate reductase subunit D; QFR subunit D
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Escherichia coli O45:K1 (strain S88 / ExPEC)
Target Names
frdD
Target Protein Sequence
MINPNPKRSDEPVFWGLFGAGGMWSAIIAPVMILLVGILLPLGLFPGDALSYERVLAFAQ SFIGRVFLFLMIVLPLWCGLHRMHHAMHDLKIHVPAGKWVFYGLAAILTVVTLIGVVTI
Uniprot No.

Target Background

Function
Two distinct, membrane-bound, FAD-containing enzymes catalyze the interconversion of fumarate and succinate. Fumarate reductase is used in anaerobic growth, while succinate dehydrogenase is used in aerobic growth. FrdD anchors the catalytic components of the fumarate reductase complex to the inner cell membrane and binds quinones.
Database Links
Protein Families
FrdD family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • How Does the Structure of Fumarate Reductase Complex Relate to Its Function?

    Structural studies have revealed that the fumarate reductase complex requires all four subunits for proper function. The FRD A and B dimer forms the catalytically active portion that reduces fumarate, while FRD C and D subunits are hydrophobic membrane proteins responsible for:

    • Anchoring the complex to the cytoplasmic membrane

    • Facilitating electron transfer from quinones to the catalytic site

    • Enabling coupling of electron transport to energy conservation

    Experiments have demonstrated that neither FRD A nor FRD B alone is enzymatically functional; only the dimer shows activity in benzyl viologen oxidase assays. Similarly, both FRD C and FRD D are required for membrane association and quinone interaction . Research has shown that separation of the genes encoding FRD C and FRD D on different plasmids prevents restoration of anaerobic growth, indicating the importance of coordinated expression .

  • What Distinguishes E. coli O45:K1 from Other E. coli Strains?

    E. coli O45:K1 (strain S88) represents a clinically significant pathogenic strain associated with extraintestinal infections, particularly neonatal meningitis. This strain belongs to the B2 phylogroup and has distinct characteristics:

    • Possesses the K1 capsular antigen, a key virulence determinant

    • Contains a pS88-like plasmid associated with invasive infection

    • Expresses specific virulence factors including yersiniabactin and salmochelin

    • Belongs to serotype O45:K1:H7

    Unlike typical intestinal pathogens, E. coli O45:K1 is part of a group of strains that can cause invasive extraintestinal infections. The strain differs from STEC (Shiga toxin-producing E. coli) serotypes like O117:H7 and O156:H7 which are primarily associated with diarrheal diseases .

Regulatory and Safety Considerations

  • What NIH Guidelines Apply to Research Using Recombinant E. coli O45:K1 frdD?

    Research involving recombinant E. coli O45:K1 frdD must adhere to NIH Guidelines for Research Involving Recombinant or Synthetic Nucleic Acid Molecules. Key considerations include:

    1. Risk assessment: E. coli O45:K1 is a pathogenic strain associated with neonatal meningitis, placing it in Risk Group 2.

    2. Required approvals: Experiments require Institutional Biosafety Committee (IBC) approval before initiation under Section III-D of the NIH Guidelines .

    3. Containment level: Work should be conducted at Biosafety Level 2 (BSL-2) with appropriate practices and facilities.

    4. Large-scale considerations: Cultures ≥10 liters require additional containment measures under Section III-D-6 .

    5. Exemptions: Some recombinant DNA experiments may be exempt under Section III-F if they meet specific criteria .

    Researchers must register their work with the institutional IBC and follow approved protocols, regardless of funding source. These regulations apply to all institutions receiving NIH funding for any recombinant DNA research .

  • What Biosafety Considerations Are Critical When Working with Recombinant E. coli O45:K1?

    When working with recombinant E. coli O45:K1 expressing frdD, several biosafety considerations are essential:

    1. Laboratory containment: Use BSL-2 practices, including:

      • Restricted laboratory access

      • Biological safety cabinet for aerosol-generating procedures

      • Appropriate personal protective equipment (lab coat, gloves, eye protection)

    2. Waste management: Treat all materials contacting the organism as biohazardous waste .

    3. Accident response: Develop specific protocols for spills or exposures.

    4. Risk mitigation strategies:

      • Use attenuated strains when possible

      • Implement biological containment through auxotrophic markers

      • Consider using expression systems with reduced viability

    5. Personnel training: Ensure all researchers are trained in proper handling of Risk Group 2 organisms and recombinant DNA.

    These measures help prevent laboratory-acquired infections and environmental release of pathogenic recombinant organisms .

  • How Should Researchers Design Experiments to Study Virulence Factors in E. coli O45:K1 While Maintaining Safety?

    Designing safe experiments to study virulence factors:

    1. Separation of virulence elements: Express individual components rather than complete virulence systems when possible.

    2. Attenuation strategies:

      • Use auxotrophic host strains requiring supplementation for growth

      • Employ biological containment systems (e.g., conditional lethal genes)

      • Implement regulated promoters that function only under laboratory conditions

    3. Methodological approaches:

      • Use surrogate non-pathogenic strains for initial studies

      • Employ in vitro systems rather than animal models when possible

      • Design experiments with the lowest virulence gene dosage necessary

    4. Documentation and approval:

      • Clearly document risk assessment

      • Obtain necessary IBC approvals before initiation

      • Consult with biosafety professionals during design phase

    For recombinant DNA research with toxin molecules (including Shiga toxin), special containment and approval requirements apply under Section III-B-1 of the NIH Guidelines .

Experimental Troubleshooting

  • What Are Common Challenges in Expressing and Purifying Functional Recombinant frdD?

    Researchers face several challenges when working with recombinant frdD:

    ChallengeCauseSolution
    Low expression levelsMembrane protein toxicityUse specialized host strains (C41/C43); lower induction temperature; regulated promoters
    Inclusion body formationProtein misfoldingCo-express with chaperones; use fusion tags that enhance solubility
    Loss of functionImproper membrane integrationExpress with other fumarate reductase subunits; optimize detergent selection
    Poor purification yieldAggregation during purificationAdd stabilizing agents; optimize detergent concentration; use mild solubilization conditions
    Limited stabilityProtein degradationInclude protease inhibitors; optimize buffer conditions; add stabilizing ligands

    Experimental evidence shows that expression of all four fumarate reductase subunits is required for function and proper membrane association. Separation of the genes encoding FRD C and FRD D on different plasmids prevents restoration of function, indicating coordinated expression is necessary .

  • How Can Researchers Distinguish Between Wild-Type and Recombinant frdD in Experimental Systems?

    Several methodological approaches can differentiate between wild-type and recombinant frdD:

    1. Epitope tagging: Addition of small epitope tags (His, FLAG, HA) to the recombinant protein allows specific detection using antibodies.

    2. Western blotting: Use of tag-specific antibodies in immunoblotting identifies only the recombinant protein.

    3. PCR-based detection: Design primers specific to the recombinant construct (spanning vector-insert junctions).

    4. Expression level differences: Recombinant proteins often show higher expression levels detectable by comparative proteomics.

    5. Functional complementation: Use frd-deficient strains (e.g., E. coli MI1443) to verify functionality of the recombinant protein in the absence of wild-type .

    When designing recombinant constructs, researchers should consider incorporating sequence variations that facilitate distinction without altering protein function.

  • What Framework Should Be Used for Reliable Experimental Design When Studying Recombinant frdD?

    A comprehensive framework for reliable experimental design when studying recombinant frdD should follow principles similar to FRED (Framework for Reliable Experimental Design) :

    1. Experimental planning:

      • Define clear research questions and hypotheses

      • Determine appropriate controls (positive, negative, vector-only)

      • Establish quantifiable outcome measures

    2. Controls and validation:

      • Include wild-type protein as reference

      • Verify protein expression (Western blotting)

      • Confirm subcellular localization (membrane fraction)

      • Validate function (complementation, enzyme activity)

    3. Data collection and analysis:

      • Use standardized protocols for consistent results

      • Implement appropriate statistical methods

      • Document all experimental conditions thoroughly

    4. Reproducibility considerations:

      • Use multiple biological replicates

      • Validate key findings with alternative methods

      • Share detailed protocols and materials

    This framework ensures robust experimental design, reliable results, and reproducible findings when working with complex membrane proteins like frdD .

Advanced Applications and Future Directions

  • How Might CRISPR-Cas9 Approaches Be Applied to Study frdD Function in E. coli O45:K1?

    CRISPR-Cas9 technology offers several powerful approaches for studying frdD function:

    1. Precise gene editing:

      • Introduction of point mutations to identify critical residues

      • Creation of domain swaps between different bacterial species

      • Generation of conditional knockdowns using inducible systems

    2. Functional genomics:

      • Systematic mutagenesis of frdD to create variant libraries

      • Coupling with selection strategies to identify functional regions

      • CRISPRi approaches for tunable repression of expression

    3. Methodological advantages:

      • Higher precision than traditional mutagenesis

      • Reduced off-target effects with optimized guide RNAs

      • Ability to create scarless mutations

    4. Regulatory considerations:

      • CRISPR-modified organisms may be subject to NIH Guidelines under Section III-D

      • Assessment of whether modifications constitute recombinant DNA

    These approaches can reveal structure-function relationships with unprecedented precision and efficiency .

  • What Role Might frdD Play in Developing Novel Antimicrobial Strategies Against Pathogenic E. coli?

    Fumarate reductase presents several opportunities for antimicrobial development:

    1. Target validation:

      • Fumarate reductase is essential for anaerobic growth

      • Inhibition could selectively target bacteria in low-oxygen infection sites

      • Specific inhibitors might preserve aerobic human metabolism

    2. Structure-based drug design approaches:

      • Targeting the membrane anchor interface between frdD and other subunits

      • Disrupting assembly of the functional complex

      • Identifying allosteric sites that affect function

    3. Potential advantages:

      • Novel target not exploited by current antibiotics

      • Possibility for reduced resistance development

      • Specificity for anaerobic pathogens

    4. Experimental strategies:

      • High-throughput screening against purified complex

      • Fragment-based drug discovery approaches

      • Computational docking using structural models

    Targeting bacterial-specific metabolic pathways like fumarate reduction offers promising avenues for addressing antimicrobial resistance in pathogenic E. coli strains .

  • How Can Systems Biology Approaches Integrate frdD Function into Understanding E. coli O45:K1 Pathogenicity?

    Systems biology approaches can contextualize frdD within broader pathogenicity mechanisms:

    1. Multi-omics integration:

      • Transcriptomics to identify co-regulated genes under infection conditions

      • Proteomics to map protein-protein interaction networks

      • Metabolomics to assess impact on bacterial metabolism during infection

    2. Computational modeling:

      • Flux balance analysis to quantify metabolic contributions

      • Network analysis to identify critical nodes in virulence

      • Agent-based modeling of host-pathogen interactions

    3. Experimental validation:

      • Transposon sequencing (Tn-seq) to identify genetic interactions

      • CRISPRi screens to map functional dependencies

      • In vivo infection models to validate predictions

    4. Data integration frameworks:

      • FRED (Feedback Reports on EMA Data) principles for data organization

      • Systematic documentation of experimental variables

      • Integration of heterogeneous data types

    These approaches can reveal how metabolic adaptations through fumarate reductase interact with classical virulence factors to enhance pathogenicity in specific host environments .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.