Recombinant Escherichia coli O45:K1 Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Escherichia coli O45:K1 Large-Conductance Mechanosensitive Channel (MscL)

The large-conductance mechanosensitive channel (MscL) in Escherichia coli (E. coli) serves as a pressure-relief valve, crucial for protecting the cell from lysis during acute osmotic downshock . MscL is a well-recognized model system for studying the molecular basis of mechanosensation through various approaches, including electrophysiology, biochemistry, genetics, structural biology, and molecular dynamic simulation . When the membrane is stretched, MscL responds to the increase of membrane tension and opens a nonselective pore to about 30 Å wide, exhibiting a large unitary conductance of ∼3 nS .

Structure of MscL

MscL is organized as symmetric oligomers with the permeation pathway formed by the packing of subunits around the axis of rotational symmetry . MscL is likely pentameric . Each subunit crosses the membrane twice through alpha-helical transmembrane segments, M1 and M2, which are interconnected by an extracellular loop . The M1 helices in the core of the transmembrane bundle make up the main gate of the mechanosensitive channel . Regularly placed glycine residues on the M1 segments permits tight packing of the five central helices, forming a narrow (~4 Å) hydrophobic constriction . Hydrophobic M2 helices on the periphery of the MscL barrel face the lipid bilayer .

Function and Mechanisms

MscL acts as a stretch-activated osmotic regulator . The bacterial mechanosensitive channels, MscL and MscS, reflect an intimate coupling of protein conformation with the mechanics of the surrounding membrane . The membrane serves as an adaptable sensor that responds to an input of applied force and converts it into an output signal .

When opened, the MscL pore expands to ~30Å in diameter . This large change accounts for the opening of the 30Å diameter pore, resulting in a 20 nm2^2 in-plane protein expansion . MscL's unitary conductance of 3nS and the channel's lack of selectivity, allowing any particles with a molecular weight smaller than ~1,000 . This property of MscL fulfills its role as an emergency valve to release solutes under osmotic shock .

Conformational Changes

The gating process of MscL involves large conformational changes when it transits from the closed state to the open state through several intermediates . In the open state, MscL dilates its central pore to ∼30 Å wide and becomes permeable to water, ions, metabolites, and even small proteins .

Medical Applications

MscL may have medical applications and can be used as a triggered nanovalve in nanodevices, including those for drug targeting . Recent studies have shown that the antibiotic streptomycin opens MscL and uses it as one of the primary paths to the cytoplasm . Moreover, the recent identification and study of novel specific agonist compounds demonstrate that the channel is a valid drug target .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mscL; ECS88_3678; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-137
Protein Length
full length protein
Species
Escherichia coli O45:K1 (strain S88 / ExPEC)
Target Names
mscL
Target Protein Sequence
MSIIKEFREFAMRGNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLIGGIDFKQFAVT LREAQGDIPAVVMHYGVFIQNVFDFLIVAFAIFMAIKLINKLNRKKEEPAAATPAPTKEE VLLTEIRDLLKEQNNRS
Uniprot No.

Target Background

Function
A mechanosensitive ion channel activated by membrane stretch. It is believed to play a role in regulating cellular osmotic pressure.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the genetic structure of the O45 antigen in E. coli O45:K1:H7 strains?

The O45 antigen gene cluster in strain S88 (O45:K1:H7) differs significantly from that in the reference strain E. coli 96-3285. Phylogenetic analysis indicates that the S88 O45 antigen gene cluster may have been acquired, at least partly, from another member of the Enterobacteriaceae through horizontal gene transfer . The unique functional organization of the two O-antigen gene clusters and the low DNA sequence homology of orthologous genes suggest a common ancestor that underwent multiple recombination events .

The O-antigen gene cluster contains genes responsible for O-unit processing, including wzx (encoding O-antigen flippase) and wzy (encoding O-antigen polymerase), which are specific for the O-unit composing the polysaccharide and serve as excellent targets for serogroup-specific PCR detection methods .

How does the MscL channel function in bacterial cell physiology?

The MscL (Mechanosensitive channel of Large conductance) is a crucial component in bacterial osmoregulation. This channel gates in response to membrane stretch, helping cells respond to changes in osmolarity. Patch-clamp experiments have confirmed its mechanosensitive properties and very large conductance .

The MscL protein consists of just 136 amino acids with a highly hydrophobic core, making it structurally distinct from porins or other known proteins . Researchers have successfully solubilized and fractionated the E. coli envelope, reconstituted MscL activity in vitro, and traced this activity to the small protein encoded by the mscL gene . Functional confirmation came through insertional disruption of mscL (which eliminated the channel activity) and re-expression of mscL (which restored it) .

What is the clinical significance of E. coli O45:K1 strains compared to other pathogenic E. coli?

E. coli O45:K1:H7 represents a highly pathogenic clone of meningitis strains that has emerged in France . While closely related to the archetypal O18:K1:H7 clone, this strain harbors the unusual serogroup O45, which has unique virulence properties .

O45 is one of the "Big Six" serotypes of Shiga toxin-producing E. coli (STEC) that causes sporadic bloody diarrhea in humans . STEC O45 strains have been implicated in serious diseases including hemolytic uremic syndrome (HUS) . The strain O45:H28 shares a common ancestor with five O157:H7 strains, including the E. coli Sakai strain isolated in Japan . Additionally, the avian pathogenic plasmid pS88 has been identified as an essential genetic element involved in the virulence of the APEC O45:K1:H7 .

How does horizontal gene transfer contribute to virulence in E. coli O45:K1 strains?

Horizontal gene transfer plays a crucial role in the acquisition of virulence determinants in pathogenic E. coli. For the O45:K1:H7 clone, phylogenetic analysis of the flanking gene gnd sequences indicates that the S88 antigen O45 gene cluster may have been acquired through horizontal transfer from another member of the Enterobacteriaceae . This acquisition appears to have been a key event in the emergence and enhanced virulence of this clone in France.

Mutagenesis studies of the O45 S88 antigen gene cluster revealed the crucial role of the O polysaccharide in S88 virulence, particularly in a neonatal rat meningitis model . The unique properties of this horizontally acquired gene cluster may provide selective advantages in host colonization, immune evasion, or tissue invasion compared to other E. coli strains. This exemplifies how horizontal gene exchange can rapidly alter pathogenicity and contribute to the emergence of new infectious disease threats.

What are the structural and functional differences between MscL channels in pathogenic versus non-pathogenic E. coli strains?

While the core structure of MscL is conserved across E. coli strains, subtle variations in amino acid sequence could potentially affect channel gating properties, membrane integration, or interactions with other cellular components. The basic MscL structure consists of a 136-amino acid protein with a highly hydrophobic core that forms a channel responsive to membrane tension .

How do single nucleotide polymorphisms (SNPs) in the O-antigen gene cluster affect the detection and characterization of E. coli O45:K1 strains?

Single nucleotide polymorphisms (SNPs) within the O-antigen gene cluster can significantly impact detection and classification strategies for E. coli O45 strains. Research has identified specific SNPs that can be used to detect STEC strains of serogroup O45 with high sensitivity and specificity .

These polymorphisms can be particularly important when designing molecular detection methods, as they provide distinguishing genetic markers that enable differentiation between closely related serotypes. The Food Safety and Inspection Service (FSIS) has recognized the importance of accurately detecting STEC serogroups including O45, emphasizing the need for sensitive and specific tests based on unique genetic signatures .

The identification of these SNPs requires comparative DNA sequence analysis across multiple strains, as was performed to identify 22 potentially informative SNPs among 164 STEC and non-STEC strains . These genetic variations can serve as the foundation for developing targeted PCR assays and other molecular diagnostic tools essential for research, clinical, and regulatory applications.

What are the optimal methods for cloning and expressing recombinant MscL in E. coli O45:K1 strains?

For successful expression of recombinant MscL in E. coli O45:K1 strains, researchers should consider both expression vector design and growth conditions:

Vector Selection and Design:

  • Use low to moderate copy number vectors to prevent toxicity from membrane protein overexpression

  • Include inducible promoters (such as T7 or araBAD) for controlled expression

  • Consider fusion tags that do not interfere with membrane insertion

  • Incorporate a ribosome binding site optimized for E. coli

Expression Protocol:

  • Transform the expression construct into E. coli O45:K1 using electroporation (preferred for pathogenic strains)

  • Grow cultures at lower temperatures (25-30°C) to facilitate proper membrane protein folding

  • Induce expression at mid-log phase (OD600 of 0.4-0.6)

  • Use low inducer concentrations to prevent formation of inclusion bodies

  • Harvest cells 3-4 hours post-induction

The success of MscL expression can be verified through patch-clamp experiments on the bacterial envelope, as demonstrated in previous studies where researchers solubilized and fractionated the envelope, reconstituted the MscL activity in vitro, and traced it to the MscL protein .

How can researchers accurately differentiate between native and recombinant MscL function in E. coli O45:K1?

To differentiate between native and recombinant MscL function, researchers should employ a multi-faceted approach:

Genetic Manipulation Strategies:

  • Create a native mscL deletion mutant as a background strain

  • Complement with a recombinant mscL gene containing subtle mutations or tags

  • Use different inducible promoters with varying expression levels

Functional Assays:

  • Patch-clamp electrophysiology to directly measure channel conductance properties

  • Osmotic shock survival assays under controlled conditions

  • Fluorescent dye efflux assays to measure channel activity in populations

Data Analysis Approaches:

  • Compare gating thresholds and conductance patterns between wild-type and recombinant strains

  • Analyze dose-dependent responses to inducer concentrations

  • Measure kinetics of channel activation under varying membrane tensions

For definitive identification, researchers can incorporate subtle modifications to the recombinant protein that don't affect function but alter detectable properties, such as addition of a small epitope tag or introduction of a conservative amino acid substitution that alters conductance in a measurable way.

What PCR-based methods are most effective for detecting and characterizing E. coli O45 strains for MscL studies?

Based on available research, the most effective PCR-based detection methods for E. coli O45 strains target the O-antigen gene cluster, specifically the wzx and wzy genes:

Target Gene Selection:

  • The wzx gene (encoding O-antigen flippase) and wzy gene (encoding O-antigen polymerase) are highly specific for the O-unit composing the polysaccharide and serve as ideal targets for PCR

  • Researchers have developed specific primers for these genes to detect strains harboring the S88 somatic antigen (O45)

PCR Protocol:

  • Prepare template DNA by mixing 2 μl of bacterial colony with 500 μl of sterile water and heating at 100°C for 10 minutes

  • Centrifuge at 11,000 × g for 3 minutes at 4°C and use the supernatant for PCR

  • Perform PCR using 0.3 μM wzx primers and 0.2 μM wzy primers in a multiplex PCR format

Confirmatory Approaches:

  • Combine PCR results with serological testing using specific antisera

  • Verify using the K1 capsular antigen detection with specific antisera and phage from reference collections

  • For more detailed characterization, analyze SNPs within the O-antigen gene cluster

This methodological approach provides high specificity for identifying E. coli O45:K1 strains suitable for MscL expression studies.

How should researchers analyze and interpret electrophysiological data from recombinant MscL channels in E. coli O45:K1?

Electrophysiological data from recombinant MscL channels requires rigorous analysis and interpretation:

Key Parameters to Measure:

  • Single-channel conductance (usually in the range of 2-3 nS for MscL)

  • Gating threshold (the membrane tension required for channel opening)

  • Channel open probability at different membrane tensions

  • Open state dwell times and sub-conductance states

  • Channel inactivation kinetics

Analysis Methodology:

  • Use patch-clamp data analysis software (e.g., Clampfit, QuB) for channel characterization

  • Create current-voltage (I-V) plots to determine channel conductance

  • Generate probability versus tension curves to determine gating sensitivity

  • Compare kinetic parameters between recombinant and wild-type channels

  • Analyze the effects of different lipid compositions on channel function

Data Interpretation Considerations:

  • Account for potential artifacts from high expression levels

  • Consider membrane lateral pressure effects from different lipid compositions

  • Evaluate temperature effects on channel gating properties

  • Interpret results in the context of the unique membrane composition of O45:K1 strains

Proper statistical analysis comparing recombinant channels to native MscL is essential, including calculation of significance values and confidence intervals for observed differences.

What are the best approaches to study the impact of O45 antigen structure on MscL function in recombinant systems?

Studying the relationship between O45 antigen structure and MscL function requires specialized approaches:

Experimental Design Strategies:

  • Create isogenic strains differing only in O-antigen gene cluster composition

  • Express identical MscL constructs in each background

  • Compare MscL function in O45-positive versus O45-negative backgrounds

  • Analyze effects of O-antigen mutations on MscL activity

Membrane Biophysics Approaches:

  • Measure membrane fluidity using fluorescence anisotropy

  • Determine lipid packing parameters and their effects on MscL gating

  • Analyze lipid-protein interactions using specific lipid probes

  • Quantify membrane mechanical properties using atomic force microscopy

Functional Correlation Analysis:

  • Relate O-antigen length/composition to MscL gating threshold

  • Determine if O45 antigen modifications affect MscL clustering in the membrane

  • Measure potential electrostatic effects of the charged O45 polysaccharide on MscL function

  • Assess osmotic protection conferred by different O-antigen variants

This comprehensive approach would help determine whether the unique O45:K1 antigen structure influences MscL function directly or indirectly through altered membrane properties.

Table 1: Characteristics of E. coli O45:K1 Strains

CharacteristicDescriptionReference
SerotypeO45:K1:H7 (S88 strain)
Phylogenetic groupRibotype B2 1
O-antigen gene clusterDiffers from reference strain 96-3285; may have been acquired from another Enterobacteriaceae
VirulenceHighly pathogenic, causes neonatal meningitis
Relation to other strainsClosely related to archetypal O18:K1:H7 clone
Geographic significanceEmerged in France
Clinical impactPart of "Big Six" STEC serotypes; causes sporadic bloody diarrhea and potentially HUS

Table 2: Characteristics of E. coli MscL (Mechanosensitive Channel of Large Conductance)

CharacteristicDescriptionReference
Protein size136 amino acids
StructureHighly hydrophobic core
FunctionGates in response to membrane stretch; important in osmoregulation
Detection methodPatch-clamp experiments on bacterial envelope
ActivationResponds to mechanical stimuli (membrane tension)
UniquenessDiffers from porins and other known proteins
Expression verificationInsertional disruption removes activity; re-expression restores it

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.