Recombinant Escherichia coli O45:K1 NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Escherichia coli O45:K1 NADH-quinone oxidoreductase subunit K (nuoK)

The nuoK subunit is a hydrophobic, membrane-embedded polypeptide encoded by the nuoK gene. It is part of the proton-pumping NADH:quinone oxidoreductase (NDH-1) in E. coli, which comprises 13 subunits. Recombinant production of this subunit enables biochemical and structural studies to elucidate its role in proton translocation and electron transport .

Key Features of the Recombinant Protein

ParameterSpecification
UniProt IDB7MG43
Expression SystemEscherichia coli
TagHis tag (position determined during production)
Amino Acid SequenceMIPLQHGLILAAILFVLGLTGLVIRRNLLFmLIGLEIMINASALAFVVAGSYWGQTDGQV MYILAISLAA...
Storage-20°C/-80°C in Tris-based buffer with 50% glycerol; avoid freeze-thaw cycles
Purity>90% (SDS-PAGE verified)

2.1. Membrane Topology and Critical Residues

The NuoK subunit contains three transmembrane helices (TM1–TM3). Mutagenesis studies highlight conserved residues essential for energy transduction:

  • Glu-36 (TM2): Substitution with alanine abolishes proton-pumping activity, indicating its role in coupling electron transfer to proton translocation .

  • Glu-72 (TM3): Mutations reduce but do not eliminate activity, suggesting a secondary role in structural stability .

  • Cytoplasmic loop residues (Arg-25, Arg-26): Simultaneous mutation disrupts NADH dehydrogenase activity, implicating this region in quinone binding or subunit interactions .

2.2. Role in Proton Translocation

NDH-1 couples electron transfer with the translocation of four protons per two electrons. NuoK contributes to this mechanism through:

  • Hydrogen-bonding networks: Membrane-embedded acidic residues (Glu-36, Glu-72) likely participate in proton channels .

  • Quinone binding: Interactions with the cytoplasmic loop may stabilize quinone intermediates during redox reactions .

3.1. Recombinant Expression

  • Host: E. coli expression systems yield soluble, active protein .

  • Tagging: A His tag facilitates affinity chromatography purification .

Research Applications

  • Mechanistic Studies: Used to investigate proton translocation dynamics in bacterial complex I .

  • Drug Development: Target for antibiotics disrupting bacterial respiration .

  • Biophysical Analysis: Structural studies via cryo-EM or X-ray crystallography .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we accommodate specific format requirements. Please indicate your preference when placing the order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. For dry ice shipping, please contact us in advance as additional fees apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which serves as a reference for your use.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
If you have a specific tag type preference, please inform us, and we will prioritize development accordingly.
Synonyms
nuoK; ECS88_2426; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Escherichia coli O45:K1 (strain S88 / ExPEC)
Target Names
nuoK
Target Protein Sequence
MIPLQHGLILAAILFVLGLTGLVIRRNLLFMLIGLEIMINASALAFVVAGSYWGQTDGQV MYILAISLAAAEASIGLALLLQLHRRRQNLNIDSVSEMRG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, through FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for this enzyme is believed to be ubiquinone. This process couples the redox reaction with proton translocation, translocating four hydrogen ions across the cytoplasmic membrane for every two electrons transferred. This mechanism conserves redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structural and functional significance of nuoK in the NADH-quinone oxidoreductase complex?

The nuoK subunit is one of 14 subunits (NuoA-N) that comprise the NADH-quinone oxidoreductase (Complex I) in E. coli. This membrane-bound protein functions as part of the first enzyme complex in the respiratory chain. The nuoK subunit is a transmembrane protein that contributes to proton translocation during the electron transfer process, playing a critical role in energy conservation mechanisms within the bacterial cell .

Within the entire nuo complex, nuoK interacts with other membrane subunits to form the proton-translocating domain. While peripheral subunits like NuoG have been more extensively characterized for their roles in complex assembly and regulation, transmembrane subunits like nuoK are essential for the proton-pumping function of the complex .

How can I express and purify recombinant nuoK protein from E. coli O45:K1?

Methodology for recombinant nuoK expression typically involves:

  • Gene cloning and vector construction:

    • Amplify the nuoK gene from E. coli O45:K1 genomic DNA using PCR

    • Clone into an appropriate expression vector (pET or pBAD systems are common choices)

    • Transform into an expression host strain (BL21(DE3) or similar)

  • Expression optimization:

    • Test multiple induction conditions (IPTG concentration, temperature, duration)

    • For membrane proteins like nuoK, lower induction temperatures (16-25°C) often yield better results

    • Consider co-expression with chaperones to improve folding

  • Purification approach:

    • Lyse cells using methods that effectively solubilize membrane proteins (detergents like DDM, LDAO)

    • Use affinity chromatography (His-tag purification is common) followed by size exclusion

    • Maintain detergent throughout purification to prevent aggregation

    • Verify protein identity by mass spectrometry and purity by SDS-PAGE

Similar recombinant protein expression protocols have been established for other E. coli proteins, with expression conditions typically including storage at 4°C short term or -20°C long term to maintain activity .

How does the nuo operon organization affect nuoK expression in E. coli O45:K1?

The nuo operon in E. coli is a complex genetic locus encoding all 14 Nuo subunits. The expression of nuoK is regulated as part of this polycistronic operon. Key considerations include:

  • Operon structure: The nuoK gene is positioned within the nuo operon, with its expression dependent on transcription from the nuo promoter

  • Regulatory elements: Expression is influenced by global regulators responding to oxygen availability and energy status

  • Co-regulation: Evidence suggests coordinated expression of all nuo genes to ensure proper stoichiometry for complex assembly

  • Strain-specific variation: While the general organization is conserved, E. coli O45:K1 strains may show specific regulatory adaptations related to pathogenicity

Experimental approaches to study nuoK expression within the nuo operon context include qRT-PCR to measure transcript levels under different conditions, reporter gene fusions to monitor promoter activity, and genetic complementation studies using controlled expression systems .

What approaches are most effective for site-directed mutagenesis of nuoK to study structure-function relationships?

Site-directed mutagenesis of nuoK requires careful experimental design due to its membrane-embedded nature and importance in complex assembly. Effective methodologies include:

  • Mutagenesis strategy selection:

    • QuikChange PCR-based methods for simple substitutions

    • Gibson Assembly for larger modifications or domain swapping

    • CRISPR-Cas9 for chromosomal modifications

  • Critical residue targeting:

    • Focus on conserved charged residues in transmembrane domains that may participate in proton channels

    • Target residues at subunit interfaces based on structural predictions

    • Create systematic alanine-scanning libraries across specific transmembrane segments

  • Functional assessment protocol:

    • Measure NADH oxidase activity in membrane preparations

    • Assess proton pumping using pH-sensitive fluorescent probes

    • Evaluate complex assembly by BN-PAGE and immunoblotting

    • Compare growth rates under respiratory vs. fermentative conditions

  • Complementation testing:

    • Express mutant variants in nuoK-deficient strains

    • Assess restoration of complex I activity and growth phenotypes

    • Use similar approaches to those developed for studying other nuo subunits like nuoG

Mutation TypeTechnical ApproachExpected OutcomesCommon Challenges
Conservative substitutionsQuikChange mutagenesisSubtle functional changesDifficult phenotypic detection
Charge alterationsGibson AssemblyDisruption of proton pathwaysProtein stability issues
Deletion constructsRestriction-ligationAssembly defectsPotential lethality
Chromosomal modificationsCRISPR-Cas9Native expression level effectsOff-target effects

How does nuoK contribute to the pathogenicity of E. coli O45:K1 strains in meningitis models?

The role of nuoK in E. coli O45:K1 pathogenicity is complex and can be investigated through several approaches:

  • Comparative genomics analysis:

    • Compare nuoK sequences between pathogenic O45:K1 and non-pathogenic strains

    • Identify strain-specific polymorphisms that might correlate with virulence

    • Assess conservation within emerging pathogenic clones like those identified in French meningitis cases

  • Mutant construction and virulence assessment:

    • Generate nuoK deletion or point mutation strains using allelic exchange methods

    • Compare growth under stress conditions relevant to host environments

    • Test invasion and survival in cellular models of blood-brain barrier

    • Evaluate virulence in animal models of meningitis

  • Metabolic contribution analysis:

    • Assess the importance of NADH-quinone oxidoreductase activity in energy generation during infection

    • Measure respiratory capacity under oxygen-limited conditions mimicking host niches

    • Determine if nuoK mutations affect resistance to oxidative stress and host defense mechanisms

  • Integration with virulence factor expression:

    • Investigate whether nuoK mutations affect expression of known virulence factors

    • Examine potential metabolic crosstalk between respiratory function and virulence gene regulation

    • Study how energy production through Complex I impacts capsule synthesis, adherence, and invasion

Research indicates that emerging pathogenic E. coli clones, including those with O45 antigen, have unique virulence characteristics . The metabolic contribution of nuoK through its role in respiration and energy production may be critical for supporting these virulence properties, similar to how other metabolic genes contribute to bacterial fitness during infection.

What methods are recommended for analyzing nuoK-protein interactions within the respiratory chain complex?

Studying nuoK interactions requires specialized techniques for membrane protein complexes:

  • Crosslinking coupled with mass spectrometry:

    • Apply membrane-permeable crosslinkers with varying spacer lengths

    • Digest complexes and identify crosslinked peptides by LC-MS/MS

    • Create distance constraint maps to validate structural models

  • Proximity labeling approaches:

    • Express nuoK fused to BioID or APEX2 enzymes

    • Identify proteins in proximity through biotinylation and streptavidin pulldown

    • Analyze by mass spectrometry using similar database search approaches as described for other E. coli proteins

  • Cryo-electron microscopy:

    • Purify intact Complex I using mild detergent solubilization

    • Perform single-particle cryo-EM analysis

    • Generate 3D reconstructions to locate nuoK and its interaction interfaces

  • Genetic interaction mapping:

    • Create synthetic genetic arrays with nuoK variants

    • Screen for suppressors or enhancers of nuoK mutation phenotypes

    • Map functional interactions through computational network analysis

TechniqueAdvantagesLimitationsData Output
Chemical crosslinkingCaptures native interactionsChallenging crosslink identificationInteraction distance constraints
BN-PAGEPreserves native complexesLimited resolutionComplex integrity and stoichiometry
Co-immunoprecipitationDetects stable interactionsRequires good antibodiesBinary interaction data
Cryo-EMHigh-resolution structural dataTechnically demanding3D structural models
Proximity labelingDetects transient interactionsPotential false positivesInteraction network maps

How can researchers resolve conflicting data about nuoK function in different E. coli strains?

Conflicting research findings regarding nuoK function can be methodically addressed through:

  • Standardized experimental frameworks:

    • Establish consistent growth conditions and media compositions

    • Use defined genetic backgrounds with complete genome sequences

    • Standardize protein expression and purification protocols

    • Control for strain-specific factors that might influence respiratory phenotypes

  • Comprehensive phenotypic characterization:

    • Compare growth kinetics across multiple carbon sources and electron acceptors

    • Measure membrane potential and proton gradient formation directly

    • Assess NADH/NAD+ ratios and electron transport chain function

    • Evaluate stress responses as seen in functional genomic studies of E. coli

  • Multi-strain comparative analysis:

    • Create isogenic mutant collections in different strain backgrounds

    • Perform parallel phenotypic and biochemical analyses

    • Conduct complementation studies with nuoK variants between strains

    • Control for differences in genetic background using whole-genome sequencing

  • Integrated data analysis approach:

    • Apply statistical methods to identify significant strain-dependent variations

    • Use meta-analysis techniques to compare results across studies

    • Develop predictive models that account for strain-specific factors

    • Validate key findings in multiple laboratories

When experimental data from different E. coli strains conflicts, researchers should consider strain-specific genetic backgrounds, as has been demonstrated with other nuo subunits like nuoG, where isogenic collections of mutants were essential for accurate functional characterization .

What are the optimal conditions for expressing functional recombinant nuoK in heterologous systems?

Expression of functional nuoK requires careful optimization of multiple parameters:

  • Expression system selection:

    • E. coli-based systems: C41(DE3) or C43(DE3) strains often perform better for membrane proteins

    • Alternative hosts: Consider Lactococcus or Bacillus for difficult-to-express proteins

    • Cell-free systems: May improve folding of challenging membrane proteins

  • Vector and fusion tag design:

    • Employ low-copy vectors with tunable promoters

    • Test multiple fusion tags (His, MBP, SUMO) for improved solubility

    • Consider dual tags for tandem purification

    • Include protease cleavage sites for tag removal

  • Optimized expression protocol:

    • Initial growth at 37°C to mid-log phase (OD600 0.4-0.6)

    • Temperature downshift to 18-25°C before induction

    • Low inducer concentration (0.1-0.4 mM IPTG)

    • Extended expression time (16-24 hours)

    • Supplementation with iron and riboflavin for cofactor availability

  • Membrane fraction preparation:

    • Gentle cell disruption methods (osmotic shock or enzymatic lysis)

    • Differential centrifugation to isolate membrane fractions

    • Solubilization screening with multiple detergents

    • Lipid supplementation during purification

Storage conditions similar to those used for other recombinant proteins (4°C short term, -20°C long term with cryoprotectants) can be adopted, with care taken to avoid freeze-thaw cycles that may disrupt membrane protein integrity .

What genetic strategies are most effective for constructing nuoK mutants in E. coli O45:K1?

Constructing nuoK mutants in pathogenic E. coli O45:K1 strains requires specialized genetic approaches:

  • Allelic exchange methods:

    • Design constructs with homology arms flanking nuoK

    • Use suicide vectors (like pMAK705) that cannot replicate at restrictive temperatures

    • Select for integrants at restrictive temperature, then for resolved mutations at permissive temperature

    • Screen using PCR to identify desired mutations

    • Verify by sequencing to confirm the absence of secondary mutations

  • CRISPR-Cas9 approaches:

    • Design sgRNAs targeting nuoK with minimal off-target potential

    • Provide repair templates with desired mutations

    • Use temperature-sensitive plasmids for transient Cas9 expression

    • Screen using phenotypic or molecular markers

    • Confirm mutations by sequencing

  • Transposon mutagenesis with targeted recovery:

    • Generate random transposon libraries

    • Screen for respiratory defects

    • Recover and sequence insertions in the nuo operon

    • Transfer specific mutations to clean backgrounds

  • Lambda-Red recombineering:

    • Express recombination functions transiently

    • Introduce PCR products with short homology arms

    • Select using antibiotic markers

    • Remove markers using FLP recombinase if needed

These approaches can be informed by successful genetic manipulation strategies used for other nuo genes, such as the construction of nuoG mutants using site-directed mutagenesis followed by homologous recombination to integrate mutations into the chromosome .

How can researchers quantitatively assess the impact of nuoK mutations on proton translocation and respiratory chain function?

Quantitative assessment of nuoK mutations requires multi-parameter analysis:

  • Enzyme activity measurements:

    • NADH:ubiquinone oxidoreductase activity in membrane preparations

    • Oxygen consumption rates using polarographic methods

    • Spectrophotometric monitoring of NADH oxidation kinetics

    • Inhibitor sensitivity profiles (rotenone, piericidin A)

  • Proton translocation assays:

    • Fluorescent pH indicators (ACMA, pyranine) to measure ΔpH formation

    • Potentiometric dyes (DiSC3) to measure membrane potential

    • Direct pH measurements in reconstituted proteoliposomes

    • Ion-selective electrode techniques for real-time proton flux

  • Respiratory chain integration analysis:

    • Oxygen consumption with different electron donors

    • Measurement of proton-motive force components

    • Determination of P/O ratios (ATP formed per oxygen consumed)

    • Assessment of alternative respiratory pathway activation

  • Structural integrity evaluation:

    • Blue native PAGE to assess complex assembly

    • Subunit-specific antibodies to quantify incorporation

    • Thermal stability assays of purified complexes

    • Protease susceptibility patterns

What bioinformatic approaches are most useful for analyzing nuoK sequence conservation and variation among pathogenic E. coli strains?

Comprehensive bioinformatic analysis of nuoK requires:

  • Sequence alignment and conservation analysis:

    • Multiple sequence alignment of nuoK across diverse E. coli strains

    • Calculation of conservation scores for each amino acid position

    • Identification of strain-specific polymorphisms

    • Correlation of sequence variations with pathotypes

  • Structural prediction and analysis:

    • Transmembrane topology prediction using algorithms like TMHMM

    • Homology modeling based on available respiratory complex structures

    • Molecular dynamics simulations to assess variant impact

    • Coevolution analysis to identify functionally coupled residues

  • Phylogenetic approaches:

    • Construct nuoK-based phylogenetic trees

    • Compare with whole-genome phylogenies

    • Identify horizontal gene transfer events

    • Assess evolutionary selection pressures (dN/dS ratios)

  • Genomic context analysis:

    • Compare nuo operon organization across strains

    • Identify regulatory element variations

    • Assess correlation with virulence-associated genetic elements

    • Map synteny across pathogenic and non-pathogenic strains

This type of analysis can help identify whether nuoK variations contribute to the pathogenicity of emerging clones like the O45:K1 strains associated with meningitis cases .

How should researchers interpret respiratory chain complex assembly defects in nuoK mutants?

Interpreting complex assembly defects requires systematic analysis:

  • Primary defect characterization:

    • Quantify subunit composition by Western blotting

    • Analyze complex stability under varying detergent conditions

    • Map subassembly accumulation patterns

    • Compare with known assembly intermediate profiles

  • Distinguishing direct vs. indirect effects:

    • Test whether defects are rescued by altered expression levels

    • Perform in vitro reconstitution experiments

    • Analyze interactions with known assembly factors

    • Compare phenotypes with mutations in interacting subunits

  • Functional consequence assessment:

    • Correlate assembly defects with activity measurements

    • Determine threshold levels required for function

    • Analyze compensatory changes in other respiratory complexes

    • Measure growth under conditions with varying respiratory demands

  • Mechanistic interpretation framework:

    • Develop models of assembly pathways

    • Map nuoK's position in the assembly sequence

    • Identify critical interaction interfaces

    • Propose specific roles in complex stability or subunit recruitment

This approach parallels successful analyses of other nuo subunits, where genetic manipulation followed by biochemical and physiological characterization revealed their roles in complex assembly and function .

What statistical approaches are recommended for analyzing variability in nuoK expression and function across experimental replicates?

Robust statistical analysis for nuoK studies should include:

  • Experimental design considerations:

    • Power analysis to determine appropriate sample sizes

    • Randomization and blinding where applicable

    • Inclusion of appropriate controls in each experimental batch

    • Biological replicates (n≥3) and technical replicates (n≥3)

  • Data preprocessing approaches:

    • Outlier detection and handling (e.g., ROUT method)

    • Normalization to account for batch effects

    • Logarithmic transformation for non-normally distributed data

    • Standardization when comparing across different experiments

  • Statistical testing framework:

    • Shapiro-Wilk test for normality assessment

    • Parametric tests (t-test, ANOVA) for normally distributed data

    • Non-parametric alternatives (Mann-Whitney, Kruskal-Wallis) for non-normal data

    • Multiple comparison corrections (Bonferroni, Benjamini-Hochberg)

  • Advanced analytical methods:

    • Mixed-effects models to account for random variation

    • Principal component analysis for multivariate data

    • Clustering algorithms to identify patterns

    • Bayesian approaches for complex experimental designs

Analysis TypeRecommended TestApplication ScenarioInterpretation Guidance
Two condition comparisonWelch's t-testExpression level changesp<0.05 with fold change >1.5
Multiple condition comparisonOne-way ANOVA with Tukey post-hocMutant series analysisFocus on adjusted p-values
Correlation analysisSpearman's rank correlationStructure-function relationshipsρ>0.7 suggests strong relationship
Time course dataRepeated measures ANOVAExpression kineticsInteraction terms indicate differential responses

How can nuoK studies contribute to understanding broader principles of membrane protein complex assembly?

Research on nuoK offers valuable insights into fundamental biological processes:

  • Model system advantages:

    • nuoK functions within one of the largest membrane protein complexes

    • The bacterial system provides genetic tractability

    • Evolutionary conservation allows translation to more complex systems

    • Multiple functional readouts enable comprehensive phenotyping

  • Assembly principle applications:

    • Deciphering ordered vs. random assembly pathways

    • Understanding co-translational vs. post-translational integration

    • Identifying critical nucleation points for complex formation

    • Revealing quality control mechanisms for membrane complexes

  • Methodological advancements:

    • Development of techniques for tracking assembly intermediates

    • Strategies for membrane protein interaction mapping

    • Approaches for correlating structure with assembly kinetics

    • Methods for single-molecule tracking of complex formation

  • Translational relevance:

    • Insights applicable to mitochondrial complex I assembly

    • Understanding pathogenic mechanisms in mitochondrial diseases

    • Principles transferable to other membrane protein complexes

    • Potential applications in membrane protein production technologies

The study of nuoK and other nuo subunits has already contributed significantly to understanding complex I assembly, with evidence that peripheral subunits like NuoG play important roles in assembly regulation .

What are the most promising directions for studying the relationship between nuoK function and bacterial pathogenesis?

Future research directions with high potential impact include:

  • Host-pathogen interaction focus:

    • Investigation of nuoK's role during different infection stages

    • Assessment of nuoK contribution to survival in specific host niches

    • Examination of how nuoK function affects virulence factor expression

    • Analysis of host immune responses to respiratory complex components

  • Metabolic adaptation perspective:

    • Studying how nuoK mutations affect adaptation to host environments

    • Measuring metabolic flux changes in respiratory mutants

    • Determining how energy production modulates virulence

    • Examining metabolic network remodeling in response to respiratory defects

  • Therapeutic targeting opportunities:

    • Evaluation of nuoK as a potential antimicrobial target

    • Screening for inhibitors specifically affecting pathogenic variants

    • Assessment of collateral effects on virulence when targeting respiration

    • Development of adjuvant approaches targeting energy production

  • Systems biology integration:

    • Multi-omics analysis of nuoK mutants during infection

    • Network modeling of respiratory chain impacts on virulence networks

    • In vivo expression profiling of respiratory complexes

    • Machine learning approaches to predict virulence from metabolic signatures

These research directions are particularly relevant for emerging pathogenic clones like the E. coli O45:K1 strains that have been associated with meningitis cases, where unique virulence characteristics may interact with respiratory functions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.