Recombinant Escherichia coli O45:K1 p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
aaeA; ECS88_3617; p-hydroxybenzoic acid efflux pump subunit AaeA; pHBA efflux pump protein A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Escherichia coli O45:K1 (strain S88 / ExPEC)
Target Names
aaeA
Target Protein Sequence
MKTLIRKFSRTAITVVLVILAFIAIFNAWVYYTESPWTRDARFSADVVAIAPDVSGLITQ VNVHDNQLVKKGQVLFTIDQPRYQKALEEAQADVAYYQVLAQEKRQEAGRRNRLGVQAMS REEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPADGWVTNLNVYTGEFITRGS TAVALVKQNSFYVLAYMEETKLEGVRPGYRAEITPLGSNKVLKGTVDSVAAGVTNASSTR DDKGMATIDSNLEWVRLAQRVPVRIRLDNQQENIWPAGTTATVVVTGKQDRDESQDSFFR KMAHRLREFG
Uniprot No.

Target Background

Function
Forms an efflux pump in conjunction with AaeB.
Database Links
Protein Families
Membrane fusion protein (MFP) (TC 8.A.1) family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the AaeA subunit and what is its function in E. coli?

AaeA (formerly designated as yhcQ) is a membrane fusion protein that forms part of the AaeAB efflux pump system in Escherichia coli. It functions in conjunction with AaeB (formerly yhcP) to create a functional efflux system that exports p-hydroxybenzoic acid (pHBA) and select aromatic carboxylic acids from the bacterial cell . The AaeA protein belongs to the membrane fusion protein family, which typically serves as a connector between inner membrane transporters and outer membrane components in Gram-negative bacteria . The primary physiological role of the AaeAB efflux system appears to be as a "metabolic relief valve" that alleviates toxic effects resulting from imbalanced metabolism .

How was the AaeA subunit discovered and characterized?

The AaeA subunit was discovered through DNA microarray analysis of E. coli gene expression alterations following exposure to p-hydroxybenzoic acid. When E. coli strain DE112 was treated with 25 mM pHBA, researchers observed significant upregulation of a putative operon then known as yhcRQP . After 60 minutes of pHBA exposure, the signals hybridizing to yhcR, yhcQ, and yhcP spotted DNAs were increased 10-, 22-, and 12-fold, respectively . Further investigation revealed that yhcQ (now aaeA) encoded a protein of the membrane fusion protein family, while the adjacent yhcP (now aaeB) encoded a protein of the putative efflux protein family . Functional characterization through mutant studies confirmed the efflux function, leading to the renaming of these genes to reflect their role in aromatic carboxylic acid efflux .

What regulates the expression of the aaeA gene?

Expression of aaeA is regulated by AaeR (formerly yhcS), a regulatory protein of the LysR family encoded by a divergently transcribed gene upstream of the aaeXAB operon . The function of AaeR in regulating expression of aaeXAB was demonstrated through mutant studies . Several aromatic carboxylic acid compounds serve as inducers of aaeXAB expression, with pHBA being a potent inducer . The highly regulated nature of this system suggests its importance in normal E. coli physiology .

How does the aaeA gene differ from other efflux pump genes in E. coli?

Unlike the clinically relevant RND efflux pumps (such as AcrAB-TolC) that confer resistance to multiple antibiotics, the AaeAB system has a relatively narrow substrate specificity, primarily exporting aromatic carboxylic acids . While AcrAB-TolC can export a wide range of antibiotics including levofloxacin and tetracycline, the AaeAB system does not contribute significantly to antibiotic resistance . Only a few aromatic carboxylic acids from hundreds of diverse compounds tested were identified as substrates of the AaeAB efflux pump, highlighting its specialized function .

What is the molecular mechanism of AaeA-mediated efflux?

The AaeA subunit functions as a membrane fusion protein that likely creates a channel between the inner and outer membranes of E. coli . Experimental evidence has shown that both AaeA and AaeB are necessary and sufficient for the efflux function, as expression of both genes suppressed pHBA hypersensitivity in a yhcS (aaeR) mutant strain . The current understanding suggests that AaeB recognizes and binds the aromatic carboxylic acid substrates, while AaeA facilitates their transport across the periplasmic space . This differs from systems like AcrAB-TolC, which require a third component (TolC) for outer membrane export .

How does the substrate specificity of AaeA differ from other efflux pump components?

The AaeAB efflux system demonstrates remarkably high substrate specificity compared to other bacterial efflux pumps. While systems like AcrAB-TolC export diverse compounds including antibiotics, dyes, and detergents, the AaeAB system primarily exports aromatic carboxylic acids . Specifically, p-hydroxybenzoic acid (pHBA) has been identified as a principal substrate, with only a limited number of structurally related aromatic carboxylic acids being recognized by the pump . This narrow substrate range suggests a specialized physiological role rather than a general detoxification function .

What evolutionary insights can be derived from studying the AaeA subunit?

The specialized nature of the AaeAB system provides interesting insights into the evolution of bacterial efflux mechanisms. Unlike broadly acting efflux pumps that likely evolved to counter environmental toxins, the AaeAB system appears to have evolved specifically to handle metabolic intermediates that may accumulate to toxic levels during normal bacterial metabolism . The role of pHBA in normal E. coli metabolism and the highly regulated expression of the AaeAB efflux system supports the hypothesis that this pump functions as a "metabolic relief valve" rather than a general resistance mechanism . This represents a different evolutionary trajectory compared to clinically relevant efflux pumps that contribute to antimicrobial resistance .

What approaches can be used to study AaeA expression and regulation?

To study AaeA expression and regulation, researchers can employ several methodological approaches:

  • DNA Microarray Analysis: This technique can be used to assess global transcriptional changes in response to pHBA exposure, as demonstrated in previous studies where E. coli cells were treated with 25 mM pHBA and harvested at 30 and 60 minutes for RNA isolation and hybridization .

  • Mutant Construction: Generating knockout mutants of aaeA, aaeB, or aaeR allows the assessment of their individual contributions to pHBA resistance .

  • Reporter Gene Assays: Fusing the aaeA promoter region to reporter genes like lacZ or GFP can provide quantitative measurements of promoter activity under various conditions or in different genetic backgrounds.

  • RT-qPCR: For more precise quantification of aaeA expression levels in response to different aromatic carboxylic acids or under various growth conditions.

These methods, individually or in combination, can provide comprehensive insights into the regulation and expression patterns of aaeA.

How can recombinant AaeA be produced for structural and functional studies?

For structural and functional studies of AaeA, researchers can consider the following approaches:

  • Cloning and Expression Systems: The aaeA gene can be cloned into expression vectors with appropriate affinity tags (His-tag, GST, etc.) for purification. Based on the membrane fusion protein nature of AaeA, expression systems optimized for membrane-associated proteins should be considered .

  • Purification Strategies: Given AaeA's likely membrane association, detergent-based extraction methods followed by affinity chromatography would be appropriate. Membrane fusion proteins typically require careful optimization of detergent types and concentrations.

  • Functional Reconstitution: For functional studies, purified AaeA can be reconstituted with AaeB in proteoliposomes to assess transport activity in vitro.

  • Structural Analysis: Techniques like X-ray crystallography, cryo-electron microscopy, or NMR spectroscopy can be employed for structural characterization, depending on protein stability and purity.

These methodological approaches would need to be optimized specifically for AaeA, considering its membrane fusion protein characteristics.

What assays can be used to measure AaeAB efflux activity?

Several experimental approaches can be employed to assess AaeAB efflux activity:

  • Growth Inhibition Assays: Comparing growth of wild-type and aaeA/aaeB mutant strains in the presence of increasing concentrations of pHBA or other potential substrates. Mutant strains lacking functional efflux components typically show increased sensitivity to substrates .

  • Complementation Studies: Reintroducing aaeA and aaeB genes into mutant strains to restore resistance to pHBA, as demonstrated in previous studies where expression of yhcQ (aaeA) and yhcP (aaeB) suppressed pHBA hypersensitivity of a yhcS (aaeR) mutant .

  • Direct Transport Measurements: Using radiolabeled or fluorescently labeled substrates to directly measure export from bacterial cells.

  • Substrate Accumulation Assays: Measuring the intracellular accumulation of pump substrates in wild-type versus mutant strains.

These assays provide complementary approaches to characterize the transport activity and substrate specificity of the AaeAB efflux system.

How can genetic screens be optimized to identify factors influencing AaeA function?

To identify factors affecting AaeA function, researchers can implement the following genetic screening approaches:

  • Transposon Mutagenesis: Random insertion mutagenesis followed by selection for altered resistance to pHBA can identify genes that influence AaeA function.

  • Suppressor Screens: Starting with an aaeA or aaeR mutant, researchers can screen for suppressors that restore pHBA resistance, potentially identifying new regulatory or functional interactions.

  • Synthetic Lethal Screens: Identifying mutations that are lethal only in combination with aaeA mutations can reveal functional redundancies or connections to essential cellular processes.

  • Two-Hybrid or Pull-Down Assays: To identify proteins that physically interact with AaeA, potentially revealing assembly partners or regulatory factors.

These screening approaches should incorporate appropriate controls and validation experiments to confirm the specificity of identified factors to AaeA function.

How should transcriptomic data on AaeA expression be analyzed in different experimental contexts?

When analyzing transcriptomic data related to AaeA expression, researchers should consider:

  • Differential Expression Analysis: Apply statistical methods to identify significantly altered gene expression levels. Previous studies showed aaeA (yhcQ) was upregulated 22-fold after pHBA exposure .

  • Correlation Analysis: Examine co-expression patterns between aaeA and other genes to identify potential functional relationships. The coordinated upregulation of aaeX, aaeA, and aaeB (10-, 22-, and 12-fold, respectively) suggests their functional relationship .

  • Regulatory Network Reconstruction: Integrate expression data with known regulatory interactions to understand how aaeA regulation fits within broader cellular responses.

  • Comparative Analysis: Compare expression profiles under different conditions or in different strains to identify condition-specific or strain-specific regulation patterns.

  • Validation: Confirm key transcriptomic findings using targeted methods such as RT-qPCR or reporter assays.

This multi-faceted approach ensures robust interpretation of transcriptomic data related to AaeA expression.

What approaches can help resolve conflicting data about AaeA function?

When faced with conflicting data regarding AaeA function, researchers should consider:

  • Strain Background Effects: The genetic background of E. coli strains can significantly influence experimental outcomes. Testing in multiple strain backgrounds can help distinguish strain-specific from general effects.

  • Experimental Condition Variations: Different growth conditions, substrate concentrations, or exposure times can lead to apparently contradictory results. Systematic variation of experimental parameters can help identify condition-dependent effects.

  • Complementation Studies: Reintroducing wild-type aaeA into mutant strains can confirm whether observed phenotypes are specifically due to AaeA function .

  • Combined Loss-of-Function and Gain-of-Function Approaches: Using both knockout mutants and overexpression systems provides complementary insights into protein function.

  • Alternative Methodologies: Employing different experimental approaches to address the same question can help resolve technical artifacts.

These strategies can help reconcile conflicting observations and develop a more accurate understanding of AaeA function.

How can substrate specificity data for the AaeAB system be systematically analyzed?

To systematically analyze substrate specificity of the AaeAB efflux system:

  • Structure-Activity Relationship Analysis: Comparing the chemical structures of compounds that are and are not substrates can reveal the molecular features required for recognition by the pump. Previous studies tested hundreds of diverse compounds but found only a few aromatic carboxylic acids were substrates .

  • Quantitative Transport Measurements: Rather than binary classification (substrate/non-substrate), quantitative measurements of transport rates can provide more nuanced understanding of substrate preferences.

  • Competition Assays: Testing whether compounds compete with known substrates can identify competitive inhibitors versus alternative substrates.

  • Molecular Docking Studies: Computational approaches can predict binding modes of potential substrates, as has been done with other efflux systems like AcrB .

  • Site-Directed Mutagenesis: Targeted mutations in AaeA or AaeB can identify residues involved in substrate recognition and transport.

This comprehensive approach can provide detailed insights into the substrate specificity determinants of the AaeAB efflux system.

What statistical approaches are most appropriate for analyzing AaeA mutant phenotype data?

When analyzing phenotypic data from AaeA mutant studies, the following statistical approaches are recommended:

  • Growth Curve Analysis: For growth inhibition assays, appropriate curve-fitting methods should be applied to extract parameters like growth rate, lag phase duration, and maximum cell density.

  • Dose-Response Modeling: When testing pHBA sensitivity at different concentrations, dose-response curves can be fitted to determine IC50 values (concentration causing 50% inhibition).

  • ANOVA and Post-Hoc Tests: For comparing multiple strains or conditions, analysis of variance followed by appropriate post-hoc tests (e.g., Tukey's HSD) can identify significant differences.

  • Non-Parametric Tests: When data do not meet normality assumptions, non-parametric alternatives like Mann-Whitney U or Kruskal-Wallis tests should be considered.

  • Replication and Power Analysis: Ensuring sufficient biological replicates and performing power analyses helps determine the reliability of observed differences.

How does the AaeA subunit compare with analogous components in other bacterial species?

While the search results focus primarily on E. coli, comparative analysis of AaeA with similar proteins in other bacteria reveals important evolutionary and functional insights. Unlike the broadly distributed RND efflux pumps found across Gram-negative bacteria, the AaeAB system appears to have a more specialized distribution . Members of the PACE (Proteobacterial Antimicrobial Compound Efflux) family, which include proteins like AceI from Acinetobacter baumannii and PA2880 from Pseudomonas aeruginosa, share some functional similarities with the AaeAB system in terms of substrate export, though they typically export biocides rather than metabolic intermediates . The combination of AaeA's membrane fusion protein characteristics with AaeB's efflux function creates a system functionally distinct from the more well-studied MacAB-TolC system, which transports macrolides in E. coli and tigecycline in A. baumannii .

What insights does AaeA provide into the evolution of bacterial efflux systems?

The AaeAB system represents an interesting case study in the evolution of bacterial efflux mechanisms. Unlike systems that primarily confer antibiotic resistance, AaeAB appears to have evolved to handle specific metabolic intermediates that may become toxic at high concentrations . This suggests that efflux pumps may have originally evolved for metabolic homeostasis rather than defense against antimicrobials. The high substrate specificity of AaeAB contrasts with the broad substrate profiles of clinically relevant efflux pumps, indicating different evolutionary pressures . The presence of a dedicated regulatory system (AaeR) that responds specifically to aromatic carboxylic acids further supports the hypothesis that this system evolved to address specific metabolic challenges rather than as a general defense mechanism .

What are the key unanswered questions about AaeA function and regulation?

Several important questions remain unanswered regarding AaeA function and regulation:

  • Structural Characterization: The three-dimensional structure of AaeA and how it interacts with AaeB remains to be elucidated.

  • Physiological Triggers: While pHBA is known to induce expression, the natural conditions under which the AaeAB system is activated in vivo are not fully characterized.

  • Regulatory Network Integration: How AaeR-mediated regulation of aaeA integrates with other cellular stress responses requires further investigation.

  • AaeX Function: The role of the small protein AaeX (yhcR) that is co-transcribed with aaeA and aaeB remains unknown .

  • Species Distribution: The prevalence and conservation of the AaeAB system across different E. coli strains and related enterobacteria needs further exploration.

Addressing these questions will provide a more complete understanding of the AaeAB efflux system and its role in bacterial physiology.

What emerging technologies could advance our understanding of AaeA?

Several cutting-edge technologies could significantly advance our understanding of AaeA:

  • Cryo-Electron Microscopy: This technique could reveal the structural details of the AaeAB complex in its native membrane environment.

  • Single-Cell Analysis: Techniques like single-cell RNA-seq could reveal cell-to-cell variability in aaeA expression and its physiological consequences.

  • Metabolomics: Comprehensive metabolomic analysis could identify additional substrates or metabolic pathways connected to AaeAB function.

  • CRISPR-Based Screening: Genome-wide CRISPR screens could identify genes that synthetically interact with aaeA or influence its expression.

  • Microfluidics: Microfluidic approaches could enable real-time monitoring of AaeAB activity in response to dynamically changing environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.