Recombinant Escherichia coli O45:K1 Phosphoglycerol transferase I (mdoB)

What is Phosphoglycerol transferase I (mdoB) and what is its function in Escherichia coli?

Phosphoglycerol transferase I is an enzyme located in the inner cytoplasmic membrane of Escherichia coli. It catalyzes the transfer of phosphoglycerol residues from phosphatidylglycerol to membrane-derived oligosaccharides (MDOs) or to model substrates such as arbutin (p-hydroxyphenyl-beta-D-glucoside). This transfer reaction produces a phosphoglycerol diester derivative of MDOs or arbutin and sn-1,2-diglyceride as a byproduct. The enzyme's active site is positioned on the outer aspect of the inner membrane, allowing it to interact with substrates in the periplasmic space. The mdoB gene encodes this enzyme, and mutations in mdoB result in the synthesis of membrane-derived oligosaccharides that lack phosphoglycerol residues .

What is the molecular characterization of Recombinant E. coli O45:K1 Phosphoglycerol transferase I?

Recombinant E. coli O45:K1 Phosphoglycerol transferase I is characterized by the following molecular properties:

The amino acid sequence begins with MSELLSFALFLASVLIYAWKAGRNTWWFA and contains transmembrane domains characteristic of membrane proteins . This recombinant protein is derived specifically from the E. coli O45:K1 strain S88, which belongs to the extraintestinal pathogenic E. coli (ExPEC) group that has been identified in cerebrospinal fluid isolates from meningitis patients .

How does mdoB contribute to bacterial membrane structure and function?

The absence of phosphoglycerol modification can affect various cellular processes, including resistance to antibiotics, adaptation to environmental stresses, and potentially virulence in pathogenic strains. The enzyme's positioning with its active site on the outer aspect of the inner membrane is strategically important for its function in modifying periplasmic components while utilizing phospholipid substrates from the cytoplasmic membrane .

What are the optimal conditions for expressing and purifying Recombinant E. coli O45:K1 Phosphoglycerol transferase I?

For optimal expression and purification of Recombinant E. coli O45:K1 Phosphoglycerol transferase I, researchers should consider the following methodological approach:

Expression System:

• Use E. coli BL21(DE3) or similar expression strains optimized for membrane protein expression

• Consider using specialized vectors containing promoters that provide controlled expression (e.g., T7 promoter system with IPTG induction)

• Incorporate a fusion tag (His-tag, GST, or MBP) to facilitate purification while maintaining enzymatic activity

Growth Conditions:

• Grow cultures at 30°C rather than 37°C to improve proper folding of membrane proteins

• Induce expression at mid-log phase (OD600 of 0.6-0.8)

• Use lower inducer concentrations (0.1-0.5 mM IPTG) and extend expression time (overnight)

• Supplement media with 0.5-1% glucose to prevent leaky expression

Purification Strategy:

• Harvest cells by centrifugation (5000×g, 15 minutes, 4°C)

• Resuspend in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, and protease inhibitors

• Disrupt cells using sonication or high-pressure homogenization

• Separate membrane fraction through ultracentrifugation (100,000×g, 1 hour, 4°C)

• Solubilize membrane proteins using 1% n-Dodecyl β-D-maltoside (DDM) or similar mild detergent

• Purify using affinity chromatography followed by size exclusion chromatography

• Store in Tris-based buffer with 50% glycerol at -20°C for short-term storage or -80°C for long-term storage

When handling the purified protein, avoid repeated freeze-thaw cycles as these can decrease enzymatic activity. Working aliquots should be stored at 4°C for no more than one week .

How can the enzymatic activity of Phosphoglycerol transferase I be accurately measured?

Accurate measurement of Phosphoglycerol transferase I activity requires careful consideration of reaction conditions and detection methods. The following protocol provides a methodological approach:

Standard Assay Method:

• Prepare reaction mixture containing:

  • 50 mM HEPES buffer (pH 7.5)

  • 10 mM MgCl₂

  • 100 mM NaCl

  • 0.1-1.0 μM purified enzyme

  • 50-100 μM phosphatidylglycerol (substrate)

  • 100-200 μM arbutin (p-hydroxyphenyl-beta-D-glucoside) or isolated MDOs (acceptor)

• Incubate at 30°C for 10-30 minutes

• Stop reaction by adding chloroform:methanol (2:1)

• Extract lipids and analyze products using:

  • Thin-layer chromatography (TLC)

  • High-performance liquid chromatography (HPLC)

  • Mass spectrometry for precise product identification

Measurement Considerations:

• Determine initial velocity (V₀) from the linear portion of the reaction progress curve to avoid limitations from substrate depletion, enzyme instability, or pH changes

• Control for background activity using heat-inactivated enzyme

• Include appropriate positive controls, such as known active enzyme preparations

• Ensure consistent enzyme concentration across experiments, as concentration variations significantly impact reproducibility

Alternative Assay Approach:
For high-throughput screening, develop a spectrophotometric assay by coupling product formation to a colorimetric reaction. For example, measure the release of diglyceride by coupling to a diglyceride lipase and measuring fatty acid release .

To ensure reproducibility, report all essential metadata including precise buffer composition (including counter-ions), pH, temperature, enzyme concentration, substrate concentration, and incubation time .

What factors affect the stability and storage of Recombinant E. coli O45:K1 Phosphoglycerol transferase I?

Multiple factors influence the stability and storage of Recombinant E. coli O45:K1 Phosphoglycerol transferase I, which researchers must consider to maintain enzyme activity:

Critical Stability Factors:

For optimal preservation of enzymatic activity, prepare small working aliquots to avoid repeated freeze-thaw cycles. Working aliquots should be stored at 4°C and used within one week . For experiments requiring extended storage, utilize preservation methods such as flash-freezing in liquid nitrogen before transferring to -80°C storage. The addition of stabilizers like trehalose (5-10%) can further enhance long-term stability by preventing protein denaturation during freeze-thaw processes.

Before experimental use, centrifuge stored samples briefly (5,000×g for 2 minutes) to remove any protein aggregates that may have formed during storage. This ensures consistent enzyme concentrations in experimental reactions, which is crucial for reproducibility of enzyme activity measurements .

How does the structure of Phosphoglycerol transferase I relate to its catalytic mechanism?

The structure-function relationship of Phosphoglycerol transferase I provides critical insights into its catalytic mechanism. While a complete high-resolution crystal structure of the E. coli O45:K1 Phosphoglycerol transferase I is not yet available, analysis of its amino acid sequence and predicted structural features reveals important functional domains:

Structural Features and Catalytic Mechanism:

• Transmembrane Domains: The N-terminal region contains multiple transmembrane helices (evident in the sequence MSELLSFALFLASVLIYAWKAGRNTWWFAATLTVLGLFVVLNITLF) that anchor the protein to the inner membrane with the catalytic domain exposed to the periplasm .

• Catalytic Domain: The periplasmic domain contains the active site with several conserved motifs, including:

  • FSHTQQLPGTDYTIAG: Contains critical residues for substrate binding

  • WGFYDDTVLDE: Involved in phosphoglycerol recognition and positioning

  • FSAVSCSQEN: Contains nucleophilic residues that participate in catalysis

• Proposed Mechanism: The enzyme likely operates through a sequential mechanism:

  • Binding of phosphatidylglycerol substrate to a hydrophobic pocket

  • Nucleophilic attack by a conserved serine or threonine residue

  • Formation of phosphoenzyme intermediate

  • Transfer of phosphoglycerol to acceptor (MDO or arbutin)

  • Release of diglyceride byproduct

The positioning of the active site on the outer aspect of the inner membrane is strategically important, allowing the enzyme to access phosphatidylglycerol in the membrane while interacting with MDOs in the periplasm. This topology explains why phosphoglycerol transferase I can catalyze the transfer of phosphoglycerol residues to arbutin added to the growth medium .

Understanding this structure-function relationship is essential for designing specific inhibitors targeting Phosphoglycerol transferase I in pathogenic E. coli strains.

What are the implications of mdoB mutations on E. coli O45:K1 pathogenesis?

The implications of mdoB mutations on E. coli O45:K1 pathogenesis are significant, particularly in the context of meningitis pathophysiology:

Impact on Bacterial Virulence:
E. coli O45:K1 belongs to a group of strains frequently isolated from cerebrospinal fluid of patients with meningitis . The mdoB gene, encoding Phosphoglycerol transferase I, plays a crucial role in modifying membrane-derived oligosaccharides that contribute to membrane integrity and bacterial adaptation to host environments.

When mdoB is mutated, the resulting bacteria produce MDOs lacking phosphoglycerol residues, which alters membrane properties in several ways that may affect virulence:

• Altered Membrane Permeability: Changes in periplasmic oligosaccharide composition may affect the permeability of the outer membrane to antimicrobial compounds, potentially enhancing resistance to host defense mechanisms.

• Modified Surface Properties: Loss of negatively charged phosphoglycerol residues from MDOs alters the surface charge distribution, potentially affecting interactions with host cells, including brain microvascular endothelial cells that form the blood-brain barrier.

• Impaired Stress Response: MDO modifications contribute to osmotic adaptation, and mdoB mutations may compromise bacterial survival during transitions between different host environments (bloodstream to cerebrospinal fluid).

• Potential Group-Specific Effects: Since E. coli K1 strains isolated from CSF can be categorized into two distinct groups with different virulence factor profiles , mdoB mutations might have variable effects depending on the strain background. Group 2 strains have been found to contain type III secretion system apparatus, while group 1 strains predominantly possess the general secretory pathway .

Experimental evidence suggests that strains with dgk mutations (defective in diglyceride kinase) accumulate sn-1,2-diglyceride when grown in arbutin-containing medium, leading to growth inhibition. Additional mutations in mdoB can confer arbutin resistance by preventing this accumulation . This metabolic relationship between phospholipid metabolism and growth regulation may have implications for bacterial adaptation during infection.

How can genome-wide studies enhance our understanding of mdoB function in different E. coli strains?

Genome-wide studies provide powerful approaches to elucidate the function of mdoB across different E. coli strains and understand its role in broader cellular networks:

Comparative Genomic Approaches:
Comparative genomic hybridization (CGH) has revealed that E. coli K1 strains isolated from cerebrospinal fluid can be divided into two distinct groups with different virulence factor profiles . This genomic diversity suggests that mdoB may function within strain-specific genetic contexts that influence its contribution to pathogenesis.

Methodological Strategies for Genome-Wide Analysis:

• Transcriptomic Profiling:

  • RNA-Seq analysis of wildtype versus mdoB mutant strains under various conditions (osmotic stress, antimicrobial exposure, host cell contact)

  • Identification of differentially expressed genes to map the regulatory networks influenced by mdoB activity

  • Time-course experiments to capture temporal aspects of gene expression changes

• Functional Genomics Approaches:

  • Transposon-insertion sequencing (Tn-Seq) to identify genetic interactions with mdoB

  • Construction of synthetic genetic arrays to map genes that exhibit synthetic lethality or suppression with mdoB mutations

  • CRISPR-Cas9 screening to identify genes that modify mdoB-related phenotypes

• Evolutionary Genomics Analysis:

  • Comparison of mdoB sequences across diverse E. coli isolates, focusing on clinical versus environmental strains

  • Analysis of selection pressure on mdoB and associated genes involved in membrane biogenesis

  • Identification of strain-specific variants that might influence enzyme function or regulation

• Integration with Pathogenesis Models:

  • Correlation of genomic variants with in vitro phenotypes (biofilm formation, invasion of human brain microvascular endothelial cells)

  • In vivo models of meningitis to assess the contribution of mdoB to blood-brain barrier traversal

  • Multi-omics integration (genomics, transcriptomics, proteomics, metabolomics) to construct comprehensive models of mdoB function

These genome-wide approaches enable researchers to move beyond isolated gene studies to understand how mdoB functions within the complex genetic background of different E. coli strains. For E. coli O45:K1, which belongs to the extraintestinal pathogenic E. coli (ExPEC) group often associated with neonatal meningitis , such studies can reveal how mdoB contributes to its specific pathogenic mechanisms compared to other K1 strains with different O-antigens.

What controls and variables must be considered when investigating Phosphoglycerol transferase I activity?

Rigorous experimental design is crucial for accurate investigation of Phosphoglycerol transferase I activity. Researchers should implement the following controls and variables:

Essential Controls:

Critical Variables to Control and Report:

• Enzyme Concentration: Precise reporting of enzyme concentration is essential for reproducibility. Many enzyme function studies fail to adequately report enzyme concentration, making replication impossible .

• Substrate Availability: Both phosphatidylglycerol (donor) and MDO/arbutin (acceptor) concentrations must be carefully controlled and reported.

• Buffer Composition: Complete buffer details including:

  • Counter-ions (often omitted in reporting)

  • Exact pH (measured at experimental temperature)

  • Presence of stabilizing agents or detergents

• Reaction Conditions:

  • Temperature (with verification of temperature stability)

  • Incubation time (with justification for time points)

  • Mixing method (important for membrane enzymes)

  • Sample volume and reaction vessel type

• Enzyme Preparation Method:

  • Purification technique

  • Storage conditions prior to assay

  • Number of freeze-thaw cycles

  • Time between purification and activity measurement

To ensure reproducibility, all these variables must be not only controlled but also thoroughly documented in research reports. Empirical analysis of enzyme function reporting has revealed that critical information is frequently omitted from published papers, preventing proper replication of results .

How should researchers approach the development of specific inhibitors for Phosphoglycerol transferase I?

Developing specific inhibitors for Phosphoglycerol transferase I requires a systematic approach combining computational, biochemical, and microbiological methods:

Inhibitor Development Strategy:

• Target Validation and Assay Development:

  • Confirm essentiality of mdoB through knockout studies in relevant pathogenic models

  • Develop a high-throughput enzymatic assay to screen potential inhibitors

  • Establish secondary assays to validate hits and eliminate false positives

  • Define criteria for inhibitor specificity (no activity against human homologs)

• Structure-Based Design Approach:

  • Use homology modeling and available structural data to create detailed models

  • Identify potential binding pockets through computational cavity detection

  • Perform virtual screening of compound libraries against identified pockets

  • Design substrate analogs targeting the active site

• Rational Design Based on Reaction Mechanism:

  • Develop transition state analogs that mimic the phosphoglycerol transfer reaction

  • Create covalent inhibitors targeting catalytic residues

  • Design bisubstrate analogs that simultaneously engage both donor and acceptor binding sites

• Fragment-Based Drug Discovery:

  • Screen fragment libraries for weak but efficient binders

  • Use X-ray crystallography, NMR, or surface plasmon resonance to validate binding

  • Expand fragments through synthetic chemistry to improve potency

  • Link binding fragments to create more potent inhibitors

• Evaluation Pipeline:

The development of selective inhibitors would not only provide tools for studying mdoB function but could also lead to novel antimicrobial agents specifically targeting pathogenic E. coli strains like O45:K1 that are associated with serious infections such as neonatal meningitis . Given the increasing problem of antimicrobial resistance, targeting non-essential but virulence-associated factors like Phosphoglycerol transferase I represents a promising strategy that may reduce selection pressure compared to conventional antibiotics.

What bioinformatic approaches can be used to analyze evolution and conservation of mdoB across bacterial species?

Bioinformatic analyses provide valuable insights into the evolution and conservation of mdoB across bacterial species, helping researchers understand its fundamental importance and species-specific adaptations:

Comprehensive Bioinformatic Analysis Workflow:

• Sequence Retrieval and Database Construction:

  • Extract mdoB sequences from diverse bacterial genomes using BLAST or profile HMMs

  • Include representatives from various bacterial phyla, with emphasis on enteric bacteria

  • Organize sequences according to taxonomic classification and ecological niche

• Sequence Conservation Analysis:

  • Perform multiple sequence alignment using MUSCLE, MAFFT, or T-Coffee

  • Calculate conservation scores for each position to identify invariant residues

  • Generate sequence logos to visualize conservation patterns

  • Map conservation onto predicted structural features

• Phylogenetic Analysis:

  • Construct phylogenetic trees using maximum likelihood or Bayesian methods

  • Compare mdoB phylogeny with species phylogeny to detect horizontal gene transfer events

  • Analyze clade-specific variations that might correlate with pathogenicity

  • Focus on differences between pathogenic strains (like E. coli O45:K1) and commensal strains

• Structural Prediction and Analysis:

  • Generate 3D structural models using homology modeling or AI-based prediction tools

  • Compare predicted structures across diverse species

  • Identify structurally conserved regions likely essential for function

  • Analyze species-specific structural variations that might reflect adaptation

• Genomic Context Analysis:

  • Examine gene neighborhood conservation across species

  • Identify syntenic blocks and operon structures

  • Analyze co-occurring genes that might functionally interact with mdoB

  • Investigate regulatory elements and their conservation

Example Conservation Analysis of Key Functional Regions:

This bioinformatic analysis reveals that Phosphoglycerol transferase I contains highly conserved catalytic regions essential for its enzymatic function, while other regions show adaptations that might reflect species-specific requirements or ecological niches. Of particular interest would be variations specific to pathogenic E. coli strains like O45:K1 that could contribute to their virulence mechanisms . These variations could be targeted for the development of pathogen-specific inhibitors or diagnostic markers.

What emerging technologies could advance our understanding of Phosphoglycerol transferase I function?

Several cutting-edge technologies are poised to revolutionize our understanding of Phosphoglycerol transferase I function and its role in bacterial physiology and pathogenesis:

Emerging Technological Approaches:

• Cryo-Electron Microscopy:

  • High-resolution structural determination of membrane-embedded Phosphoglycerol transferase I

  • Visualization of enzyme-substrate complexes in near-native environments

  • Time-resolved cryo-EM to capture different conformational states during catalysis

• Single-Molecule Enzymology:

  • Real-time observation of individual enzyme molecules using fluorescence techniques

  • Direct measurement of conformational changes during substrate binding and product release

  • Determination of kinetic heterogeneity not detectable in bulk assays

• CRISPR-Based Genome Editing:

  • Precise modification of mdoB sequence to study structure-function relationships

  • Creation of conditional knockdowns to study essentiality under different conditions

  • Base editing to introduce specific amino acid substitutions without disrupting gene structure

• Advanced Mass Spectrometry:

  • Native mass spectrometry to analyze enzyme-substrate complexes

  • Hydrogen-deuterium exchange mass spectrometry to probe dynamic conformational changes

  • Cross-linking mass spectrometry to map interaction interfaces with binding partners

  • Lipidomics approaches to comprehensively characterize membrane changes in mdoB mutants

• Microfluidics and Organ-on-Chip:

  • Controlled microenvironments to study enzyme function under physiologically relevant conditions

  • Blood-brain barrier models to investigate the role of mdoB in E. coli O45:K1 meningitis pathogenesis

  • High-throughput screening of inhibitors in complex tissue-like environments

• Synthetic Biology Approaches:

  • Engineering orthogonal mdoB variants with modified substrate specificity

  • Creation of biosensors for phosphoglycerol transferase activity in live cells

  • Designing minimal systems to reconstitute MDO biosynthesis in artificial membranes

These technologies will enable researchers to address fundamental questions about Phosphoglycerol transferase I that remain challenging with conventional approaches, particularly regarding its dynamics within the membrane environment, its interactions with other membrane components, and its precise role in bacterial pathogenesis.

How might understanding mdoB function contribute to novel antimicrobial strategies?

Understanding mdoB function provides several promising avenues for developing novel antimicrobial strategies against pathogenic E. coli strains such as O45:K1, which is associated with neonatal meningitis :

Innovative Antimicrobial Approaches Based on mdoB:

• Direct Enzyme Inhibition:

  • Development of small molecule inhibitors targeting the catalytic site

  • Membrane-penetrating peptidomimetics that disrupt enzyme-substrate interactions

  • Allosteric inhibitors that stabilize inactive conformations

• Membrane Perturbation Strategy:

  • Compounds that compete with natural substrates (phosphatidylglycerol)

  • Agents that alter membrane composition to indirectly affect enzyme function

  • Targeting the unique membrane environment required for optimal enzyme activity

• Virulence Attenuation:

  • Anti-virulence compounds that don't kill bacteria but reduce pathogenicity

  • Molecules that prevent phosphoglycerol modification of MDOs without affecting growth

  • Combination approaches targeting multiple non-essential virulence factors

• Immunomodulatory Approaches:

  • Vaccines targeting surface-exposed regions of Phosphoglycerol transferase I

  • Antibody-antibiotic conjugates for targeted delivery to pathogens

  • Immunostimulatory compounds that enhance host recognition of modified bacterial surfaces

• Synthetic Biology Solutions:

  • Engineered phages targeting bacteria expressing specific mdoB variants

  • CRISPR-Cas delivery systems to selectively disrupt mdoB in pathogens

  • Probiotic strains engineered to outcompete pathogens through modified MDO biosynthesis

Advantages of mdoB-Targeted Antimicrobial Strategies:

• Reduced Selection Pressure: Since mdoB mutations affect virulence but may not be lethal under all conditions, targeting this enzyme might impose less selection pressure than conventional antibiotics that target essential functions.

• Pathogen Specificity: Targeting unique features of E. coli O45:K1 Phosphoglycerol transferase I could provide specificity against pathogenic strains while sparing beneficial microbiota.

• Novel Mechanism of Action: As an unexploited target, mdoB-directed therapeutics would face no pre-existing resistance mechanisms.

• Biofilm Disruption Potential: MDOs contribute to bacterial surface properties that influence biofilm formation; disrupting their modification could enhance susceptibility to host defenses and conventional antibiotics.

As antibiotic resistance continues to rise as a global health threat, such alternative approaches targeting non-essential but virulence-associated factors like Phosphoglycerol transferase I represent an important frontier in antimicrobial development. E. coli O45:K1, as a significant cause of neonatal meningitis , represents a high-priority target for such novel therapeutic strategies.