Recombinant Escherichia coli O45:K1 Potassium-transporting ATPase C chain (kdpC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
kdpC; ECS88_0730; Potassium-transporting ATPase KdpC subunit; ATP phosphohydrolase [potassium-transporting] C chain; Potassium-binding and translocating subunit C; Potassium-translocating ATPase C chain
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-190
Protein Length
full length protein
Species
Escherichia coli O45:K1 (strain S88 / ExPEC)
Target Names
kdpC
Target Protein Sequence
MRGLRPALSTFLFLLLITGGVYPLLTTALGQWWFPWQANGSLIREGDTVRGSALIGQNFT GNGYFHGRPSATAEMPYNPQASGGSNLAVSNPELDKQIAARVAALRAANPDASTNVPVEL VTASASGLDNNITPQAAAWQIPRVAKARNLSVEQLTQLIAKYSQQPLVKYIGQPVVNIVE LNLALDRLDE
Uniprot No.

Target Background

Function

This protein is a component of the high-affinity ATP-driven potassium transport (Kdp) system. It catalyzes ATP hydrolysis, coupled with the electrogenic transport of potassium ions into the cytoplasm. Specifically, this subunit functions as a catalytic chaperone, enhancing the ATP-binding affinity of the ATP-hydrolyzing subunit KdpB through the formation of a transient KdpB/KdpC/ATP ternary complex.

Database Links
Protein Families
KdpC family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the KdpC subunit and its role in the KdpFABC complex?

KdpC functions as a catalytic chaperone within the high-affinity potassium uptake complex KdpFABC found in Bacteria and Archaea. The KdpFABC complex represents a unique chimera that combines elements of ion pumps and ion channels, with KdpC playing a specialized role that differs from both typical P-type ATPases and ion channels . KdpC contains a single transmembrane helix and has no known homologues in other protein families . Its primary function is to facilitate ATP binding and hydrolysis by interacting with the nucleotide-binding loop of KdpB, thereby enhancing the complex's ability to transport potassium ions against their concentration gradient .

How does the KdpFABC complex maintain potassium homeostasis in prokaryotes?

The KdpFABC complex is an oligomeric K+ transport system that helps prokaryotes maintain ionic homeostasis under stress conditions, particularly during potassium limitation . This ATP-driven complex comprises a channel-like subunit (KdpA) from the superfamily of K+ transporters and a pump-like subunit (KdpB) from the superfamily of P-type ATPases . The transport mechanism involves a series of coordinated steps:

  • K+ ions from the periplasm enter through the selectivity filter (SF) of KdpA

  • The ions move through an intramembrane tunnel to the Bx site in KdpB

  • ATP hydrolysis by KdpB drives conformational changes that release K+ to the cytoplasm

During this process, KdpC enhances ATP binding and hydrolysis efficiency, optimizing energy utilization for potassium transport .

What is the structural composition of KdpC?

KdpC is characterized by a single transmembrane helix and a structure that remains relatively static during the conformational changes that occur in the KdpB subunit during the reaction cycle . The protein contains a conserved glutamine residue that is crucial for high-affinity nucleotide binding to the KdpFABC complex . This conserved residue enables KdpC to coordinate ATP nucleotide via double hydrogen bonds, similar to the LSGGQ signature motif found in ABC transporters .

How does KdpC interact with other subunits in the KdpFABC complex?

KdpC interacts primarily with the nucleotide-binding loop of KdpB in an ATP-dependent manner around the ATP-binding pocket . Through this interaction, KdpC increases ATP-binding affinity by forming a transient KdpB/KdpC/ATP ternary complex . While KdpB undergoes significant conformational changes during the reaction cycle (transitioning between E1 and E2 states), KdpC, along with KdpA and KdpF, remains static . This static nature suggests that KdpC provides structural stability to the complex while facilitating ATP binding and hydrolysis through specific interactions with KdpB.

How does KdpC function as a catalytic chaperone in ATP binding?

KdpC employs a unique nucleotide-binding mechanism that parallels aspects of ABC transporters rather than typical P-type ATPases . The catalytic chaperone function involves several key mechanisms:

  • Conserved glutamine coordination: KdpC contains a conserved glutamine residue that coordinates ATP via double hydrogen bonds, similar to the LSGGQ signature motif in ABC transporters .

  • Ribose recognition: Both ATP binding to KdpC and ATP hydrolysis activity of KdpFABC are sensitive to the accessibility, presence, or absence of the hydroxyl groups at the ribose moiety of the nucleotide, indicating specific structural recognition .

  • Ternary complex formation: KdpC interacts with the nucleotide-binding loop of KdpB to form a transient KdpB/KdpC/ATP ternary complex, which enhances ATP-binding affinity .

This unique mechanism represents an evolutionary adaptation that enables the KdpFABC complex to function as a hybrid of ion pumps and ion channels, optimizing energy utilization for high-affinity potassium transport under stress conditions.

What mechanisms enable the KdpC subunit to increase ATP-binding affinity in the KdpFABC complex?

The ATP-binding affinity enhancement by KdpC involves several specialized mechanisms:

MechanismDescriptionFunctional Significance
Ternary complex formationKdpC interacts with KdpB's nucleotide-binding loop in an ATP-dependent mannerCreates a stable environment for ATP binding and hydrolysis
Conserved glutamine coordinationSimilar to ABC transporters, coordinates ATP through double hydrogen bondsProvides precise positioning of ATP for optimal interaction
Ribose hydroxyl recognitionSensitive to the accessibility and presence of hydroxyl groups on ATP's riboseEnsures specificity of nucleotide binding

These mechanisms collectively enhance the ATP-binding affinity of the complex, representing a unique adaptation that blends features of ion pumps and ion channels . The increased affinity optimizes energy utilization for potassium transport under conditions where potassium is limited.

How does the KdpC subunit remain static during conformational changes in the KdpB subunit?

Structural studies using cryo-electron microscopy have revealed that while KdpB undergoes significant conformational changes during the reaction cycle, KdpC remains remarkably static . This structural stability likely stems from:

  • Limited transmembrane presence (a single transmembrane helix) reducing conformational flexibility

  • Specific interaction with KdpB's nucleotide-binding domain rather than its membrane domain

  • Potential stabilizing interactions with KdpA and KdpF, which also remain static during the transport cycle

What experimental methods are most effective for studying the interaction between KdpC and KdpB?

Several experimental approaches have proven effective for investigating the KdpC-KdpB interaction:

MethodApplicationTechnical Considerations
Cryo-electron microscopyStructural determination of KdpFABC in various enzymatic statesSamples prepared by plunge freezing on Ultrafoil grids; imaging with Titan Krios microscope
Site-directed mutagenesisIdentifying critical residues in the KdpC-KdpB interactionFocus on conserved glutamine and other residues at the interaction interface
ATP binding assaysAssessing affinity and kinetics of ATP bindingCan be modified to test various ATP analogues under different conditions
Coupled enzyme assaysMeasuring ATPase activity of the KdpFABC complexUseful for assessing functional consequences of mutations in KdpC
Proteoliposome reconstitutionEvaluating K+ transport activity in a membrane environmentMonitoring with voltage-sensitive dyes or by capacitative coupling

Combining these approaches provides a comprehensive understanding of both structural and functional aspects of the KdpC-KdpB interaction, enabling insights into the unique catalytic chaperone mechanism.

How can the function of KdpC be assessed in proteoliposome reconstitution experiments?

Proteoliposome reconstitution offers a powerful approach to assess KdpC function within a membrane environment. A methodological workflow includes:

  • Protein purification:

    • Express KdpFABC (wild-type or with KdpC mutations) in E. coli using the endogenous promoter responsive to K+ deficiency

    • Purify using Ni-NTA affinity chromatography followed by size-exclusion chromatography

    • Maintain in buffer containing 25 mM Tris pH 7.5, 10% glycerol, 1 mM TCEP, appropriate salt, and 0.15% n-decyl-β-maltoside

  • Proteoliposome preparation:

    • Reconstitute purified KdpFABC into liposomes of defined lipid composition

    • Verify lipid content by liquid chromatography–mass spectrometry

  • Transport activity measurement:

    • Monitor electrogenic K+ transport using voltage-sensitive dyes (DisC3) or by capacitative coupling (SURFE2N1)

    • Compare transport rates and K+ affinity between wild-type and KdpC mutants

    • Assess ATP dependence by varying ATP concentration

  • Data analysis:

    • Determine kinetic parameters (KM, Vmax) for K+ transport

    • Correlate changes in transport activity with specific mutations in KdpC

What are the implications of targeting KdpC for developing novel antimicrobial strategies?

Targeting KdpC presents a promising avenue for antimicrobial development for several reasons:

  • Essential function: The KdpFABC complex is crucial for bacterial survival under potassium-limited conditions . E. coli with the K1 capsule, which can express this complex, are known to cause invasive diseases including bloodstream infections and meningitis in newborns .

  • Unique target: KdpC has no known homologues in other protein families , potentially allowing for selective targeting without affecting host proteins. Its distinctive nucleotide-binding mechanism provides a specific target for inhibitor design .

  • Prevalence in pathogens: Approximately 25% of all current E. coli strains responsible for blood infections contain the genetic information related to the K1 capsule , suggesting that targeting KdpC could address a significant portion of pathogenic E. coli.

  • Alternative approach: Rather than targeting the bacterial capsule directly, inhibiting KdpC could provide an alternative to conventional antibiotics, potentially bypassing existing resistance mechanisms. Research has demonstrated that targeting bacterial capsules can make pathogens more vulnerable to the immune system .

Development strategies could focus on designing inhibitors that disrupt the KdpC-KdpB interaction or prevent KdpC from functioning as a catalytic chaperone, thereby compromising bacterial potassium homeostasis under stress conditions.

What expression systems are most suitable for producing recombinant KdpC for structural and functional studies?

The most effective expression system for recombinant KdpC production utilizes E. coli with the endogenous kdp promoter that responds to potassium limitation. A methodology based on established protocols includes:

  • Expression strain selection: E. coli strains with the kdpD and kdpE genes present in the chromosome are ideal, as these genes regulate kdp expression in response to potassium limitation .

  • Growth conditions optimization:

    • Initial culture in K5-medium (K0-medium supplemented with 5 mM KCl) at 37°C overnight

    • Transfer to K1-medium (K0-medium supplemented with 1 mM KCl) and incubate at 37°C for 8 hours

    • K0-medium composition: 46 mM Na2PO4, 23 mM NaH2PO4, 25 mM (NH4)2SO4, 0.4 mM MgSO4, 6 μM FeSO4, 1 mM sodium citrate, 0.2% glucose, 1μg/mL thiamine, 50 μg/mL carbenicillin

  • Protein purification considerations:

    • Affinity tags should be designed to minimize interference with KdpC function

    • Purification buffers should maintain the integrity of the KdpFABC complex

    • Detergent selection is critical for maintaining function during purification

This expression system leverages the natural regulation of the kdp operon to produce functional KdpC within the context of the entire KdpFABC complex, which is essential for studying its role as a catalytic chaperone.

How can researchers distinguish between the roles of KdpC and KdpB in ATP binding and hydrolysis?

Distinguishing the specific contributions of KdpC and KdpB requires methodological approaches that selectively alter each subunit's function:

By systematically applying these approaches, researchers can delineate the specific contributions of KdpC as a catalytic chaperone versus KdpB as the primary ATPase in the complex.

How does the K1 capsule relate to KdpC function in pathogenic E. coli strains?

The relationship between the K1 capsule and KdpC function in pathogenic E. coli represents an important area for investigation:

  • Evolutionary relationship: Research has revealed that the K1 capsule dates back approximately 500 years earlier than previously thought, highlighting its importance for bacterial survival . The KdpFABC complex, including KdpC, similarly represents an ancient adaptation for potassium homeostasis under stress conditions .

  • Pathogenicity factors: E. coli with the K1 capsule are known to cause invasive diseases such as bloodstream infections and meningitis in newborns, with mortality rates as high as 40% . The KdpFABC complex may contribute to survival within the host environment where potassium availability may be limited.

  • Prevalence and significance: Approximately 25% of all current E. coli strains responsible for blood infections contain the genetic information needed to develop the K1 capsule . Understanding the role of KdpC in these strains could reveal important virulence mechanisms.

  • Therapeutic targeting: Research has demonstrated that targeting the bacterial capsule can make pathogens more vulnerable to the immune system . Similarly, targeting KdpC could compromise bacterial survival under stress conditions, potentially enhancing host immune clearance.

The interconnection between capsule formation and potassium homeostasis mechanisms represents a promising area for further investigation, particularly in understanding how these systems contribute to bacterial pathogenesis and survival within the host.

What experimental models are most appropriate for studying KdpC function in the context of bacterial infections?

Investigating KdpC function in infection contexts requires carefully selected experimental models:

Model TypeApplicationsAdvantagesLimitations
In vitro human serum resistanceAssess survival of KdpC mutants compared to wild-typeDirectly measures interaction with human immune components Lacks complexity of in vivo environment
Cell culture infection modelsStudy bacterial invasion and intracellular survivalControls for specific host cell interactionsMay not reflect systemic aspects of infection
Animal infection modelsEvaluate virulence in vivoProvides physiologically relevant environmentEthical considerations; species differences
Ex vivo tissue modelsAssess tissue-specific interactionsMaintains tissue architecture while allowing manipulationLimited duration; lacks systemic immune components

When designing these models, researchers should consider:

  • Creating isogenic KdpC mutants in K1 E. coli clinical isolates

  • Developing conditional expression systems to modulate KdpC levels during different infection stages

  • Implementing potassium-restricted conditions to highlight KdpC's role in bacterial adaptation

  • Combining kdpC mutations with disruptions to the K1 capsule to assess potential synergistic effects

These experimental approaches can provide valuable insights into how KdpC function contributes to bacterial pathogenesis and survival during infection, potentially revealing new therapeutic targets.

What are the most promising approaches for developing KdpC-targeted antimicrobial compounds?

Based on current understanding of KdpC function, several promising drug development strategies emerge:

  • Structure-based inhibitor design:

    • Target the conserved glutamine residue essential for ATP coordination

    • Design compounds that disrupt the KdpB/KdpC/ATP ternary complex formation

    • Develop allosteric inhibitors that alter KdpC conformation and prevent interaction with KdpB

  • Peptide-based approaches:

    • Design peptide mimetics of the KdpB nucleotide-binding loop that interacts with KdpC

    • Develop cell-penetrating peptides that selectively bind to KdpC and disrupt its function

  • Combination therapies:

    • Pair KdpC inhibitors with conventional antibiotics to enhance efficacy

    • Combine with compounds that target K1 capsule formation to increase bacterial susceptibility to immune clearance

  • High-throughput screening platforms:

    • Develop assays that specifically measure KdpC-KdpB interaction

    • Screen compound libraries against purified KdpC or the KdpFABC complex

    • Utilize bacterial growth assays under potassium-limited conditions to identify potential inhibitors

These approaches could lead to novel antimicrobial compounds that target an essential bacterial function while potentially circumventing existing resistance mechanisms. The unique nature of KdpC as a catalytic chaperone with no known homologues in other protein families suggests the possibility of developing highly selective inhibitors with minimal off-target effects.

How might advances in understanding KdpC function contribute to addressing antimicrobial resistance?

The rise in hypervirulent and multi-drug resistant E. coli strains over the last decade makes developing effective strategies to prevent and treat infections increasingly urgent . Advances in understanding KdpC function could contribute to addressing antimicrobial resistance through several mechanisms:

  • Novel target exploitation: KdpC represents a previously unexploited antimicrobial target with no counterpart in conventional antibiotic strategies, potentially bypassing existing resistance mechanisms .

  • Potentiation of immune clearance: Similar to targeting the K1 capsule, inhibiting KdpC function could potentially make bacteria more vulnerable to host immune defenses by compromising adaptation to stress conditions .

  • Combination therapy approaches: KdpC inhibitors could potentially sensitize resistant bacteria to conventional antibiotics by disrupting potassium homeostasis and stress adaptation mechanisms.

  • Targeted therapy development: The prevalence of K1 capsule genes in approximately 25% of E. coli strains causing bloodstream infections suggests that targeting KdpC could address a significant subset of clinically relevant pathogens .

By elucidating the fundamental mechanisms of KdpC function and its role in bacterial survival under stress conditions, researchers can develop novel therapeutic approaches that target essential bacterial processes while minimizing selection pressure for conventional resistance mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.