Recombinant Escherichia coli O45:K1 Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE (arnE)

Shipped with Ice Packs
In Stock

Description

Introduction to ArnE in E. coli O45:K1

ArnE, previously designated as PmrL, functions as a subunit of a specialized membrane flippase that translocates 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (undecaprenyl phosphate-α-L-Ara4N) from the cytoplasmic side to the periplasmic side of the bacterial inner membrane . This protein belongs to the arnBCADTEF operon (formerly known as pmrHFIJKLM), which plays a crucial role in lipid A modification and polymyxin resistance in Gram-negative bacteria .

E. coli O45:K1 strain S88 represents a highly pathogenic clone that has emerged in France, where it accounts for approximately one-third of E. coli neonatal meningitis cases . This strain belongs to the highly virulent subgroup B2(1) and has garnered significant research interest due to its clinical importance and distinctive genomic characteristics .

Protein Sequence and Properties

While the exact amino acid sequence for the E. coli O45:K1 ArnE is not explicitly provided in the available data, comparative analysis with homologous proteins from related bacterial species provides valuable insights. The ArnE proteins typically consist of 111-115 amino acid residues and are characterized as small membrane proteins with multiple transmembrane domains .

Based on homologous sequences from other E. coli strains and related bacteria, the general structure of ArnE includes:

  • Multiple transmembrane helices that anchor the protein within the inner membrane

  • Hydrophobic regions essential for interaction with lipid substrates

  • Conserved domains characteristic of the EamA-like transporter family

Role in Lipid A Modification

The primary function of ArnE is as a component of a flippase complex that facilitates the translocation of undecaprenyl phosphate-α-L-Ara4N across the bacterial inner membrane . This process is critical for the addition of 4-amino-4-deoxy-L-arabinose (Ara4N) to lipid A, a key component of bacterial lipopolysaccharide (LPS) .

The lipid A modification pathway involves several sequential steps:

  1. Formation of undecaprenyl phosphate-4-deoxy-4-formamido-L-arabinose (C55P-Ara4FN) by ArnC

  2. Deformylation by ArnD to generate undecaprenyl phosphate-4-deoxy-4-amino-L-arabinose (C55P-Ara4N)

  3. Translocation of C55P-Ara4N across the inner membrane by the ArnE/ArnF flippase complex

  4. Transfer of Ara4N to lipid A by ArnT on the periplasmic side

This pathway results in the addition of positively charged Ara4N groups to the phosphate moieties of lipid A, which reduces the net negative charge of the bacterial outer membrane.

ArnE/ArnF Flippase Complex

ArnE functions in conjunction with ArnF (formerly PmrM) to form a functional flippase complex. Experiments involving chromosomal inactivation of these genes in E. coli with a constitutively active PmrA (pmrAc) demonstrated their essential role in transporting undecaprenyl phosphate-α-L-Ara4N across the inner membrane . Notably, deletion of either gene results in loss of polymyxin resistance, highlighting their critical importance in this resistance mechanism .

Polymyxin Resistance Mechanism

The modification of lipid A with Ara4N serves as a critical defense mechanism against cationic antimicrobial peptides, particularly polymyxins such as colistin . This modification reduces the net negative charge of lipid A from -1.5 to 0, significantly impairing the binding of cationic antimicrobial peptides to the bacterial membrane .

Research has demonstrated that Ara4N can be present in more than 85% of LPS molecules in resistant bacteria, providing substantial protection against polymyxin antibiotics . This mechanism represents a significant concern given that polymyxins often serve as last-resort antibiotics for multidrug-resistant Gram-negative infections.

Regulatory Control

The expression of the arnBCADTEF operon is primarily controlled by the PmrA/PmrB and PhoP/PhoQ two-component regulatory systems . Activation of PmrA results in transcription of both pmrE (ugd) and the arnBCADTEF operon, leading to the expression of enzymes responsible for lipid A modification with Ara4N .

Importantly, constitutively active pmrA (pmrAc) mutants of E. coli and Salmonella Typhimurium exhibit polymyxin resistance, underscoring the central role of this regulatory pathway in antimicrobial resistance .

Genomic Characteristics

E. coli O45:K1 strain S88 represents a highly virulent clone that has emerged as a significant cause of neonatal meningitis in France . This strain belongs to phylogenetic group B2 and ribotype B2 1, which are associated with enhanced virulence potential .

The S88 strain harbors a large plasmid (pS88) that is 133,853 bp in length and contains 144 protein-coding genes . This plasmid carries multiple virulence factors, including:

  • Three different iron uptake systems (aerobactin, salmochelin, and sitABCD genes)

  • Several putative virulence genes (iss, etsABC, ompT(P), and hlyF)

The pS88 sequence shares homology with avian pathogenic E. coli plasmids, suggesting potential interspecies transmission of virulence determinants .

O-Antigen Structure and Virulence

The O45 antigen of strain S88 plays a crucial role in its virulence. Research has demonstrated that the S88 O-antigen gene cluster sequence differs significantly from that of the reference O45 strain (E. coli 96-3285), suggesting that while they share some epitopes, they represent distinct antigens .

Phylogenetic analysis based on flanking gene sequences indicates that the S88 antigen O45 gene cluster may have been acquired, at least in part, from another member of the Enterobacteriaceae family through horizontal gene transfer . This acquisition appears to have been a key event in the emergence and enhanced virulence of the E. coli O45:K1:H7 clone in France .

Mutagenesis studies of the O45 antigen gene cluster have revealed its crucial role in S88 virulence in a neonatal rat meningitis model, highlighting the importance of this surface structure in pathogenicity .

Expression Systems and Purification

Recombinant ArnE proteins from various bacterial species, including E. coli strains, are typically produced using E. coli expression systems with N-terminal His tags to facilitate purification . The general approach to producing recombinant ArnE involves:

  1. Cloning the arnE gene into an appropriate expression vector

  2. Transformation into E. coli expression strains

  3. Induction of protein expression

  4. Purification using affinity chromatography (typically via the His tag)

  5. Lyophilization for long-term storage

The resulting recombinant proteins typically achieve purities greater than 90% as determined by SDS-PAGE analysis .

Sequence Conservation and Diversity

ArnE proteins from different bacterial species show varying degrees of sequence similarity. While the core functional domains remain conserved, species-specific variations exist that may reflect adaptations to different environmental niches or antimicrobial pressures.

Bacterial SpeciesSimilarity to E. coli ArnENotable Differences
Pseudomonas aeruginosaModerate (~60-70%)Extended protein length (115 aa), different distribution of charged residues
Salmonella TyphimuriumHigh (~85-90%)Highly conserved functional domains with minor sequence variations
Shigella flexneriVery high (~95-98%)Nearly identical sequence, reflecting close evolutionary relationship to E. coli

These comparative analyses provide valuable insights into the evolution and functional conservation of ArnE across different bacterial pathogens.

Functional Conservation

Despite sequence variations, the fundamental function of ArnE appears to be conserved across different bacterial species. In all studied organisms, ArnE contributes to lipid A modification with Ara4N and subsequent polymyxin resistance . This functional conservation highlights the evolutionary importance of this antimicrobial resistance mechanism.

Targeting ArnE for Antimicrobial Development

Given the critical role of ArnE in polymyxin resistance, this protein represents a potential target for novel antimicrobial development. Inhibitors of the ArnE/ArnF flippase complex could potentially restore susceptibility to polymyxins in resistant bacteria, providing a strategy to combat antimicrobial resistance.

Immunological Applications

Recombinant ArnE could serve as a potential antigen for vaccine development or diagnostic applications targeting pathogenic E. coli strains, particularly the virulent O45:K1 clone implicated in neonatal meningitis.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary based on the purchase method and location. Please contact your local distributor for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C, while lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
arnE; ECS88_2408; Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE; L-Ara4N-phosphoundecaprenol flippase subunit ArnE; Undecaprenyl phosphate-aminoarabinose flippase subunit ArnE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Escherichia coli O45:K1 (strain S88 / ExPEC)
Target Names
arnE
Target Protein Sequence
MIWLTLVFASLLSVAGQLCQKQATCFAAVNKRRKHIVLWLGLALACLGLAMVLWLLVLQN VPVGIAYPMLSLNFVWVTLAAVKLWHEPVSLRHWCGVAFIIGGIVILGSTV
Uniprot No.

Target Background

Function
This protein functions as a translocator that moves 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (alpha-L-Ara4N-phosphoundecaprenol) across the inner membrane, from the cytoplasmic side to the periplasmic side.
Database Links
Protein Families
ArnE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is ArnE and what is its functional role in Escherichia coli O45:K1?

ArnE (previously designated as PmrM) is a probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit found in Escherichia coli O45:K1. It functions as part of a membrane transport system that facilitates the movement of undecaprenyl phosphate-α-L-Ara4N across the inner bacterial membrane . This protein works in conjunction with ArnF (previously PmrL) to form what appears to be a complete flippase complex. The primary function of this flippase is to transport the L-Ara4N moiety to the outer surface of the inner membrane, where it can subsequently be transferred to lipid A by ArnT .

The biological significance of this function lies in its contribution to antimicrobial resistance. Modification of lipid A with L-Ara4N is required for resistance to polymyxin and other cationic antimicrobial peptides in various Gram-negative bacteria . The complete pathway involves several steps:

  • Conversion of UDP-glucose to UDP-glucuronic acid

  • Oxidative decarboxylation by ArnA to generate UDP-4-ketopentose

  • Transamination by ArnB to generate UDP-β-L-Ara4N

  • N-formylation by the N-terminal domain of ArnA

  • Transfer to undecaprenyl phosphate by ArnC

  • Deformylation by ArnD

  • Transport across the inner membrane by ArnE/ArnF

  • Transfer to lipid A by ArnT

This comprehensive pathway represents a sophisticated bacterial adaptation mechanism against host immune defenses and antibiotics.

What are the recommended protocols for expressing and purifying recombinant ArnE?

Expressing and purifying membrane proteins like ArnE presents significant challenges due to their hydrophobic nature. The following methodology has proven effective:

Expression System Selection:

  • E. coli BL21(DE3) strains with specialized modifications for membrane protein expression

  • C41(DE3) or C43(DE3) strains that are optimized for toxic membrane proteins

  • Tunable expression systems using rhamnose or arabinose-inducible promoters to control expression levels

Expression Protocol:

  • Transform expression plasmid into appropriate host strain

  • Grow culture at 37°C to mid-log phase (OD600 0.6-0.8)

  • Reduce temperature to 18-20°C before induction

  • Induce with low concentrations of inducer (0.1-0.5 mM IPTG or equivalent)

  • Continue expression for 16-20 hours

Membrane Isolation:

  • Harvest cells and resuspend in buffer containing protease inhibitors

  • Disrupt cells using French press or sonication

  • Remove cell debris by low-speed centrifugation

  • Isolate membrane fraction using ultracentrifugation (100,000 × g for 1 hour)

Solubilization and Purification:

  • Solubilize membrane proteins using mild detergents (DDM, LMNG, or Brij-35)

  • Perform affinity chromatography using appropriate tags

  • Consider size exclusion chromatography as a final purification step

  • Maintain protein in stabilizing buffer containing detergent above critical micelle concentration

The purified protein can be stored at -20°C or -80°C in a buffer containing 50% glycerol and should be kept at 4°C for short-term use. Repeated freezing and thawing should be avoided .

How can I design mutational studies to investigate the functional domains of ArnE?

Mutational studies are essential for understanding structure-function relationships in ArnE. A systematic approach should include:

Target Selection:

  • Conserved residues identified through sequence alignment with homologous proteins

  • Charged or polar residues within predicted transmembrane domains

  • Residues at predicted protein-protein interaction interfaces with ArnF

  • Regions implicated in substrate binding based on computational models

Mutation Types:

  • Alanine scanning: Replace residues with alanine to neutralize side chain functions

  • Conservative substitutions: Replace with amino acids of similar properties

  • Radical substitutions: Replace with amino acids of opposite properties

  • Deletion or truncation mutants: Remove portions of the protein

Functional Assays:

  • Antibiotic susceptibility testing (MIC determination for polymyxin)

  • In vitro flippase activity assays

  • Protein-protein interaction studies with ArnF

  • Lipid A modification analysis by mass spectrometry

The mutational data should be mapped onto structural models to develop a comprehensive understanding of ArnE function. Additionally, complementation studies in arnE knockout strains can provide in vivo validation of functional predictions.

How does ArnE contribute to antimicrobial resistance and virulence in E. coli O45:K1?

ArnE plays a critical role in antimicrobial resistance and virulence through several mechanisms:

Antimicrobial Peptide Resistance:
The ArnE/ArnF flippase complex facilitates the transport of undecaprenyl phosphate-L-Ara4N across the inner membrane, which is essential for the modification of lipid A with L-Ara4N . This modification confers resistance to polymyxins and other cationic antimicrobial peptides by reducing the negative charge of the bacterial outer membrane, thereby decreasing the electrostatic attraction of these positively charged antimicrobials.

Host Immune Evasion:
The modification of lipid A alters its recognition by host pattern recognition receptors, potentially enabling the bacterium to evade innate immune responses. This is particularly relevant for E. coli O45:K1 strains, which are associated with neonatal meningitis and need to survive in the bloodstream.

Contribution to Virulence:
The E. coli O45:K1 strain represents a highly pathogenic clone that has emerged in France and has been associated with neonatal meningitis . The O45 antigen, which differs from the reference O45 strain, has been shown to play a crucial role in virulence in a neonatal rat meningitis model . The proper assembly and transport of cell surface polysaccharides, which depends partly on flippase activity, is essential for full virulence expression.

Experiments with knockout mutants have demonstrated that disruption of the L-Ara4N modification pathway significantly attenuates bacterial survival in the presence of antimicrobial peptides and reduces virulence in animal models, highlighting the importance of ArnE in pathogenesis.

What is the relationship between ArnE and the unique O-antigen structure in E. coli O45:K1?

The relationship between ArnE and the O-antigen structure in E. coli O45:K1 involves complex interactions within bacterial cell envelope biogenesis:

O-antigen Characteristics in E. coli O45:K1:
The O-antigen gene cluster of E. coli O45:K1 strain S88 differs significantly from that of the reference O45 strain (96-3285), suggesting they represent two different antigens despite sharing some epitopes . The S88 O-antigen cluster contains nine open reading frames spanning 8,379 bp with low G+C content (30.6-46.9%) compared to the E. coli core genome (51%) .

Functional Organization:
Phylogenetic analysis indicates that the S88 O45 gene cluster may have been acquired, at least partly, from another member of the Enterobacteriaceae through horizontal gene transfer . This acquisition appears to have been a key event in the emergence and virulence of the E. coli O45:K1:H7 clone .

Research has shown that mutations affecting lipid A modifications can alter O-antigen expression levels and distribution, suggesting a potential indirect relationship between ArnE function and O-antigen presentation that warrants further investigation.

What methods can be employed to visualize and quantify the flippase activity of ArnE?

Visualizing and quantifying flippase activity presents significant technical challenges. The following methodologies have been developed or adapted for ArnE research:

Fluorescence-Based Assays:

  • NBD-labeled lipid analogs: Monitor the translocation of fluorescently labeled lipid substrates across membrane bilayers

  • FRET-based systems: Utilize fluorescence resonance energy transfer between donor and acceptor fluorophores positioned on opposite sides of the membrane

  • pH-sensitive fluorescent probes: Detect changes in local environment associated with flipping events

Biochemical Approaches:

  • Accessibility assays using membrane-impermeable reagents such as sulfo-NHS-biotin

  • Back-extraction assays with albumin or cyclodextrin

  • Reconstitution of purified ArnE into liposomes and measurement of substrate transport

Mass Spectrometry Analysis:

  • Direct detection of L-Ara4N-modified lipid A species

  • Comparative lipidomics to assess changes in membrane composition

  • Stable isotope labeling to track substrate movement

Computational Models:

  • Molecular dynamics simulations of ArnE-mediated transport

  • Prediction of energetic barriers during substrate translocation

  • Structure-based models of the transport cycle

A particularly informative technique involves reconstituting purified ArnE and ArnF into proteoliposomes with embedded fluorescent reporters, allowing real-time monitoring of flippase activity under controlled conditions. This approach can be combined with site-directed mutagenesis to map functional domains and assess the impact of specific residues on transport efficiency.

How can I develop specific inhibitors targeting ArnE for antimicrobial development?

Developing specific inhibitors against ArnE represents a promising approach for new antimicrobial agents. A systematic drug discovery workflow should include:

Target Validation:

  • Confirm essentiality of ArnE for antimicrobial resistance using knockout studies

  • Determine minimum inhibitory concentrations (MICs) of existing antibiotics against wild-type and arnE-deficient strains

  • Validate in animal infection models

Structure-Based Design:

  • Generate computational models of ArnE structure

  • Identify potential binding pockets using pocket detection algorithms

  • Perform virtual screening of compound libraries

  • Prioritize compounds based on predicted binding energy and drug-likeness

High-Throughput Screening:

  • Develop cell-based assays measuring antimicrobial susceptibility

  • Establish biochemical assays using purified ArnE

  • Screen diverse chemical libraries

  • Perform secondary confirmation assays on primary hits

Lead Optimization:

  • Determine structure-activity relationships

  • Improve potency, selectivity, and pharmacological properties

  • Test for synergy with existing antibiotics

  • Assess activity against resistant clinical isolates

Given ArnE's role in antimicrobial resistance, inhibitors targeting this protein could potentially restore the efficacy of polymyxins against resistant strains. Furthermore, combination therapy approaches pairing ArnE inhibitors with conventional antibiotics may provide synergistic effects and reduce the development of resistance.

How does ArnE from E. coli O45:K1 compare to homologous proteins in other pathogenic bacteria?

Comparative analysis of ArnE across bacterial species reveals important insights into functional conservation and specialization:

SpeciesProtein NameSequence Identity (%)Functional EquivalenceStructural Features
E. coli O45:K1ArnE100Complete111 aa, multiple TMDs
Salmonella entericaArnE~70-80CompleteSimilar topology, conserved motifs
Klebsiella pneumoniaeArnE~65-75CompleteAdditional C-terminal region
Pseudomonas aeruginosaArnE ortholog~40-50PartialLarger protein with extra domains
Acinetobacter baumanniiArnE-like~35-45UnknownSignificant sequence divergence

The L-Ara4N modification pathway, including ArnE, represents an ancient and conserved mechanism for adaptation to environmental stresses and host immune defenses. Phylogenetic analysis suggests that horizontal gene transfer events have contributed to the distribution of this pathway across diverse bacterial lineages.

What is known about the evolutionary origin of the arnE gene in the E. coli O45:K1 strain?

The evolutionary history of arnE in E. coli O45:K1 reflects complex genetic dynamics:

Horizontal Gene Transfer:
Analysis of the O-antigen gene cluster in E. coli O45:K1 (strain S88) indicates that significant portions of its genomic content may have been acquired through horizontal gene transfer from other members of the Enterobacteriaceae . This is evidenced by the low DNA sequence homology of orthologous genes and unique functional organization compared to reference strains.

Phylogenetic Analysis:
Examination of the flanking gene gnd sequences suggests that the S88 antigen O45 gene cluster, which is proximal to the arn operon, has undergone multiple recombination events since diverging from a common ancestor . This genetic plasticity likely facilitated the acquisition and integration of various virulence factors, including components of the L-Ara4N modification pathway.

Selective Pressure:
The conservation of arnE and related genes across pathogenic strains suggests strong selective pressure for maintaining this genetic machinery. Antimicrobial peptides produced by host immune systems likely served as evolutionary drivers for the acquisition and retention of these resistance mechanisms.

The emergence of the highly pathogenic E. coli O45:K1:H7 clone in France represents a recent evolutionary event in which horizontal acquisition of new genetic elements, including potentially the arnE gene or its regulatory elements, has contributed to enhanced virulence and host adaptation .

What are the current limitations in structural studies of membrane proteins like ArnE?

Structural studies of membrane proteins like ArnE face several significant challenges:

Technical Limitations:

  • Protein expression and purification difficulties due to hydrophobicity

  • Maintaining protein stability outside the membrane environment

  • Obtaining sufficient quantities of pure, homogeneous protein

  • Selecting appropriate membrane mimetics for structural studies

Methodological Challenges:

  • X-ray crystallography: Difficulty in forming well-ordered crystals

  • Cryo-EM: Size limitations for small membrane proteins like ArnE

  • NMR spectroscopy: Signal overlap and broadening due to detergent micelles

  • Computational predictions: Limited accuracy for membrane proteins

Future Approaches:

  • Lipid cubic phase crystallization for X-ray studies

  • Advanced detergents and nanodiscs for improved protein stability

  • Cryo-EM with improved direct electron detectors

  • Integration of multiple structural techniques with computational modeling

The determination of high-resolution structures of bacterial flippases remains a significant hurdle in the field. Recent technological advances, such as AlphaFold2 and improved cryo-EM methodologies, may accelerate progress in this area, providing crucial insights into the mechanisms of membrane transport proteins like ArnE.

What are promising future research directions for understanding ArnE function in antibiotic resistance?

Several promising research directions could advance our understanding of ArnE's role in antibiotic resistance:

Systems Biology Approaches:

  • Global transcriptomics and proteomics to understand regulatory networks

  • Metabolic flux analysis to quantify the impact of ArnE on LPS biosynthesis

  • Network modeling to identify synergistic targets for combination therapy

Advanced Imaging Techniques:

  • Super-resolution microscopy to visualize ArnE localization and dynamics

  • Single-molecule tracking to monitor protein movement within membranes

  • FRET-based sensors to detect conformational changes during transport

Synthetic Biology Tools:

  • Engineered strains with controllable ArnE expression

  • Modified ArnE variants with enhanced or altered activity

  • Biosensors for detecting L-Ara4N modification in real-time

Translational Research:

  • Development of high-throughput screening platforms for ArnE inhibitors

  • Validation of ArnE as a therapeutic target in diverse clinical isolates

  • Exploration of adjuvant therapies that target L-Ara4N modification pathways

By combining these approaches, researchers can develop a comprehensive understanding of ArnE function and exploit this knowledge for novel antimicrobial strategies. The increasing threat of multidrug-resistant Gram-negative infections underscores the importance of targeting membrane modification systems like the ArnE/ArnF flippase complex.

Concluding Perspectives

The study of ArnE in E. coli O45:K1 represents an important frontier in understanding bacterial resistance mechanisms and virulence. This flippase subunit plays a crucial role in modifying bacterial cell surfaces to evade host defenses and resist antibiotics. Future research should focus on integrating structural, functional, and systems-level approaches to fully elucidate the role of ArnE in bacterial pathogenesis and exploit this knowledge for therapeutic innovations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.