Recombinant Escherichia coli O45:K1 Probable intracellular septation protein A (yciB)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Escherichia coli O45:K1 Probable Intracellular Septation Protein A (YciB) is a genetically engineered form of the YciB protein, a membrane-associated bacterial factor implicated in cell envelope synthesis and division. Produced in E. coli expression systems, this recombinant protein enables detailed study of YciB’s structural and functional roles in bacterial physiology and pathogenesis .

Biological Role of YciB in E. coli O45:K1

YciB is a 199-amino-acid inner membrane protein with five transmembrane domains . Key functional insights include:

  • Cell Division Regulation: YciB interacts directly with ZipA, a critical cell division protein, to modulate septum formation and cell fission . Deletion of yciB shortens cell length, while overexpression causes elongation .

  • Envelope Integrity: YciB synergizes with DcrB to maintain cell envelope stability. Dual deletion of yciB and dcrB induces membrane vesiculation, peptidoglycan mislocalization, and cell lysis .

  • Osmoregulation: The ΔyciB mutant exhibits heightened susceptibility to low osmolarity, suggesting a role in osmotic stress response .

Expression Systems

Recombinant YciB is typically expressed in E. coli K-12 derivatives (e.g., BL21 or C43 strains) using plasmids with inducible promoters (e.g., T7/lacUV5) . The O45:K1 serotype-specific YciB variant (UniProt ID: B7MG55) is purified via affinity tags and validated using SDS-PAGE (>85% purity) .

Role in E. coli O45:K1 Virulence

  • Meningitis Association: E. coli O45:K1 is a neonatal meningitis pathogen. Genomic studies classify O45:K1 strains into two groups with distinct virulence factor profiles, including variations in lipoproteins and secretion systems .

  • Synergy with Toxins: Clinical O45:H2 strains carrying Shiga toxin (Stx) and locus of enterocyte effacement (LEE) genes demonstrate enhanced pathogenicity, though YciB’s direct involvement requires further study .

Key Experimental Observations

StudyKey FindingCitation
YciB-ZipA InteractionYciB stabilizes ZipA’s septal localization, independent of PBP3-mediated pathways
Membrane Topology AnalysisConfirmed five transmembrane domains via bacterial two-hybrid assays
Envelope Stress in ΔyciB ΔdcrBLethal inner membrane-peptidoglycan linkages observed

Applications and Implications

  • Drug Target Potential: YciB’s role in envelope integrity makes it a candidate for antimicrobial strategies targeting cell division .

  • Biotechnological Use: Recombinant YciB serves as an antigen for antibody development and a tool for studying bacterial morphogenesis .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
yciB; ECS88_1324; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-179
Protein Length
full length protein
Species
Escherichia coli O45:K1 (strain S88 / ExPEC)
Target Names
yciB
Target Protein Sequence
MKQFLDFLPLVVFFAFYKIYDIYAATAALIVATAIVLIYSWVRFRKVEKMALITFVLVVV FGGLTLFFHNDEFIKWKVTVIYALFAGALLVSQWVMKKPLIQRMLGKELTLPQSVWSKLN LAWAVFFILCGLANIYIAFWLPQNIWVNFKVFGLTALTLIFTLLSGIYIYRHMPQEDKS
Uniprot No.

Target Background

Function
This protein plays a crucial role in cell envelope biogenesis, maintaining cell envelope integrity and membrane homeostasis.
Database Links
Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is YciB and what is its primary function in Escherichia coli?

YciB is an inner membrane protein in Escherichia coli whose function has not been fully characterized, but experimental evidence indicates it plays critical roles in cell envelope synthesis, cell elongation, and cell division processes. The protein contains five transmembrane domains and interacts with various proteins involved in cell elongation and cell division complexes . It is encoded by the yciB gene and has been identified as important for maintaining normal biofilm formation and interacts genetically with rodZ, a gene crucial for maintaining rod-type morphology in E. coli . The protein is classified as a "probable intracellular septation protein A," suggesting its involvement in the cell division process, particularly in septum formation .

What is the membrane topology of YciB?

The membrane topology of YciB has been experimentally verified using a dual pho-lac reporter system. The protein contains five transmembrane domains that anchor it to the inner membrane of E. coli . This structure allows YciB to interact with both cytoplasmic and periplasmic components, facilitating its role in coordinating cell envelope synthesis with cell division. The experimentally determined topology confirms previously predicted computational models of the protein structure . Understanding this topology is essential for elucidating how YciB interacts with other proteins in the cell elongation and division machinery.

What phenotypes are associated with yciB deletion mutants?

Deletion of the yciB gene results in several distinct phenotypes that provide insights into its function:

  • Increased susceptibility to low osmolarity conditions

  • Abnormal biofilm formation

  • Cell morphology defects (by association with rodZ)

These phenotypes collectively suggest that YciB plays a significant role in maintaining cell envelope integrity and proper cell division. Similar to YhcB (another cell division protein), yciB deletion might lead to impaired septum formation and cell division defects, although the specific mechanisms may differ .

How does YciB interact with cell elongation and division proteins?

YciB has been found to interact with various proteins involved in cell elongation and division complexes as determined through bacterial two-hybrid system analysis . Drawing parallels with YhcB, which also functions in cell division, these interactions likely include components of both the elongasome (responsible for lateral cell wall synthesis) and the divisome (responsible for septum formation) .

Protein Interaction PartnerComplexFunctionDetection Method
RodZElongasomeCell shape maintenanceBacterial two-hybrid
Cell division proteinsDivisomeSeptum formationBacterial two-hybrid

The interaction with RodZ is particularly significant as RodZ is essential for maintaining rod-type morphology in E. coli. This interaction suggests that YciB may help coordinate the activities of the elongasome and divisome during the cell cycle . Researchers investigating these interactions should consider using techniques such as co-immunoprecipitation or FRET analysis to further validate and characterize these protein-protein interactions.

What is the relationship between YciB and peptidoglycan synthesis?

While direct evidence specifically for YciB is limited in the provided search results, the related protein YhcB provides insights into probable mechanisms. Deletion mutants for cell division proteins often show hypersensitivity to cell wall-targeting antibiotics, suggesting impaired peptidoglycan synthesis or integrity . YciB likely plays a role in coordinating peptidoglycan synthesis with membrane invagination during cell division.

Researchers can investigate this relationship by:

  • Analyzing peptidoglycan composition in yciB deletion mutants

  • Using fluorescent D-amino acid analogs (such as NADA) to visualize peptidoglycan synthesis patterns

  • Examining the effect of peptidoglycan synthesis inhibitors on cells with altered YciB expression levels

How conserved is YciB across bacterial species?

YciB appears to be conserved across gamma-proteobacteria, suggesting evolutionary importance for its function. By analogy with YhcB, which contains a Domain of Unknown Function (DUF1043) conserved across gamma-proteobacteria , YciB likely represents a protein family with conserved function in related bacterial species. Sequence alignment and phylogenetic analysis of YciB homologs could provide insights into evolutionarily conserved regions that are likely functionally important. Researchers should consider comparative genomic approaches to identify conserved interaction networks across different bacterial species.

What techniques can be used to study YciB localization and dynamics in cells?

Multiple complementary approaches can be employed to study YciB localization:

  • Fluorescent protein fusions: Creating YciB-GFP (or other fluorescent protein) fusions to track localization during the cell cycle using fluorescence microscopy

  • Immunofluorescence microscopy: Using antibodies against YciB for immunolabeling, similar to the approach used for FtsZ visualization in YhcB studies

  • Super-resolution microscopy: Techniques such as STORM or PALM can provide nanometer-scale resolution of YciB localization relative to other division proteins

  • Time-lapse microscopy: To track dynamic changes in YciB localization during cell growth and division

When designing fluorescent fusion proteins, researchers should carefully validate that the fusion does not disrupt protein function by complementation studies in yciB deletion strains.

How can researchers generate and characterize yciB mutants effectively?

To generate and properly characterize yciB mutants:

  • Gene deletion strategies:

    • Precise deletion using λ-Red recombination system

    • Complementation with wild-type yciB to confirm phenotype specificity

  • Point mutation generation:

    • Site-directed mutagenesis targeting conserved residues

    • Creation of mutation libraries to identify functional domains

  • Phenotypic analyses:

    • Growth curves under various stress conditions (osmotic stress, temperature)

    • Microscopic examination of cell morphology

    • Antibiotic susceptibility testing (particularly cell wall-targeting antibiotics)

    • Biofilm formation assays

  • Protein interaction studies:

    • Two-hybrid assays with known interaction partners following mutations

    • Pull-down assays to confirm affected interactions

Creating point mutations in conserved domains, similar to the approach used for YhcB (where mutations in residues H76, A78, S80, S81, L84, P86, P94, and F95 affected interactions with multiple proteins) , could help identify critical functional regions of YciB.

What methods are appropriate for studying YciB's role in septum formation?

To investigate YciB's role in septum formation, researchers should consider:

  • Visualization techniques:

    • Membrane staining with FM4-64 or similar dyes to visualize septum invagination

    • Immunofluorescence microscopy to track FtsZ ring formation in yciB mutants

    • Peptidoglycan labeling using fluorescent D-amino acids (NADA or EDA-DA) to assess septal peptidoglycan synthesis

  • Biochemical approaches:

    • Assessment of peptidoglycan composition in yciB mutants

    • Protein-protein interaction studies with known divisome components

  • Live cell imaging:

    • Time-lapse microscopy to track division dynamics in wild-type versus mutant cells

    • Microfluidic approaches to monitor single-cell division events under controlled conditions

These methodologies would help determine whether YciB, like YhcB, affects FtsZ ring formation and septum development .

How might targeting YciB function lead to novel antimicrobial strategies?

Given YciB's apparent role in cell division and envelope integrity, it represents a potential target for antimicrobial development. Several approaches might be considered:

  • Small molecule inhibitors:

    • Targeting YciB-specific protein-protein interactions with divisome or elongasome components

    • Disrupting YciB membrane insertion or folding

  • Peptide-based inhibitors:

    • Designing peptides that mimic interaction interfaces to competitively inhibit natural interactions

  • Target validation approaches:

    • Studying susceptibility of yciB mutants to existing antibiotics

    • Identifying synthetic lethal interactions that could inform combination therapies

The fact that deletion mutants show increased susceptibility to cell wall-targeting antibiotics suggests that YciB inhibitors might be particularly effective in combination with existing β-lactam antibiotics.

What experimental conditions should be optimized when working with recombinant YciB protein?

When working with recombinant YciB protein such as the Escherichia coli O45:K1 probable intracellular septation protein A, researchers should consider the following optimizations:

  • Storage and stability:

    • Store at -20°C for routine use, or -80°C for extended storage

    • Avoid repeated freeze-thaw cycles as this may compromise protein integrity

    • Working aliquots can be stored at 4°C for up to one week

  • Buffer conditions:

    • Tris-based buffer with 50% glycerol is recommended for optimal stability

    • Buffer composition should be optimized specifically for the intended experimental application

  • Expression and purification strategies:

    • As a membrane protein, detergent selection is critical for maintaining native structure

    • Consider using mild detergents or nanodiscs for functional studies

    • Tag position (N- or C-terminal) should be carefully considered based on the protein's topology

These conditions ensure maximum protein stability and activity for subsequent experimental applications.

What are the remaining knowledge gaps regarding YciB function?

Despite progress in characterizing YciB, several important knowledge gaps remain:

  • Precise molecular mechanism:

    • The exact molecular function of YciB in cell division remains unclear

    • The specific coordination mechanism between elongasome and divisome components needs further elucidation

  • Structural details:

    • High-resolution structural information for YciB is lacking

    • Structure-function relationships of different domains remain to be determined

  • Regulatory mechanisms:

    • How YciB expression and activity are regulated during the cell cycle

    • Post-translational modifications that might affect YciB function

  • Species-specific functions:

    • Potential differences in YciB function between commensal and pathogenic E. coli strains

    • Comparative studies with YciB homologs from other bacterial species

Addressing these knowledge gaps would significantly advance our understanding of bacterial cell division and might inform new antimicrobial strategies.

How might systems biology approaches enhance our understanding of YciB function?

Systems biology approaches can provide a more comprehensive understanding of YciB function by:

  • Network analysis:

    • Mapping the complete protein-protein interaction network of YciB

    • Identifying genetic interactions through genome-wide synthetic genetic arrays

  • Multi-omics integration:

    • Combining transcriptomics, proteomics, and metabolomics data from yciB mutants

    • Constructing predictive models of cell division incorporating YciB function

  • Computational modeling:

    • Developing mathematical models of divisome assembly including YciB

    • Simulating the effects of YciB perturbations on cell division dynamics

  • Comparative genomics:

    • Analyzing YciB conservation and co-evolution with interaction partners across bacterial species

    • Identifying potential species-specific functional adaptations

These approaches would place YciB in a broader cellular context and help elucidate its system-level contributions to bacterial physiology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.