Recombinant Escherichia coli O45:K1 Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on your purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, working aliquots may be stored at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
lgt; ECS88_3123; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Escherichia coli O45:K1 (strain S88 / ExPEC)
Target Names
lgt
Target Protein Sequence
MTSSYLHFPEFDPVIFSIGPVALHWYGLMYLVGFIFAMWLATRRANRPGSGWTKNEVENL LYAGFLGVFLGGRIGYVLFYNFPQFMADPLYLFRVWDGGMSFHGGLIGVIVVMIIFARRT KRSFFQVSDFIAPLIPFGLGAGRLGNFINGELWGRVDPNFPFAMLFPGSRTEDILLLQTN PQWQSIFDTYGVLPRHPSQLYELLLEGVVLFIILNLYIRKPRPMGAVSGLFLIGYGAFRI IVEFFRQPDAQFTGAWVQYISMGQILSIPMIVAGVIMMVWAYRRSPQQHVS
Uniprot No.

Target Background

Function
Prolipoprotein diacylglyceryl transferase (Lgt) from Escherichia coli O45:K1 catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of prolipoprotein diacylglyceryl transferase (Lgt) in E. coli?

Lgt catalyzes the first step in the post-translational modification of bacterial lipoproteins by transferring a diacylglyceryl moiety from phosphatidylglycerol to the sulfhydryl group of the invariant cysteine residue in the lipobox of preprolipoproteins. This modification is essential for proper lipoprotein anchoring to the membrane and subsequent processing. The reaction converts preprolipoproteins to prolipoproteins, releasing glycerol phosphate as a byproduct. In E. coli and most Gram-negative bacteria, this process is critical for maintaining outer membrane integrity and cellular viability. The enzyme recognizes the conserved lipobox motif present in the signal peptide of preprolipoproteins as they exit the Sec or Tat translocon .

Why is Lgt considered essential in E. coli but not in some other bacteria?

Lgt is essential in most proteobacteria including E. coli because these organisms rely heavily on properly modified lipoproteins for cell envelope integrity and function. Depletion studies in E. coli demonstrate that reduced Lgt levels lead to severe growth impairment, morphological defects, and ultimately cell death. Even in the absence of the major lipoprotein Lpp, the lgt gene cannot be deleted in E. coli, indicating that other lipoproteins play crucial roles in cell envelope biogenesis and viability . In contrast, Lgt is not essential in certain bacteria like Corynebacterium glutamicum, where the lgt gene can be deleted without lethal consequences. This difference likely reflects variations in cell envelope architecture and the relative importance of lipoproteins in maintaining envelope integrity across bacterial species .

How does Lgt contribute to bacterial membrane integrity in E. coli?

Lgt ensures proper membrane integrity through the lipidation of numerous outer membrane lipoproteins that perform critical structural and functional roles. When Lgt is depleted in uropathogenic E. coli, the outer membrane becomes permeabilized, resulting in increased sensitivity to serum killing and antibiotics. This permeabilization occurs because unlipidated preprolipoproteins cannot be properly anchored to the membrane, disrupting the normal architecture of the cell envelope. Properly modified lipoproteins contribute to membrane stability by forming connections between the outer membrane and peptidoglycan layer, maintaining proper spacing between membranes, and facilitating the assembly of outer membrane protein complexes. Without Lgt activity, these processes are compromised, leading to envelope stress and eventually cell death .

What are the key structural features of E. coli Lgt revealed by crystallography?

The crystal structure of E. coli Lgt has been resolved at high resolution (1.6-1.9 Å) in complex with phosphatidylglycerol and the inhibitor palmitic acid. These structures reveal that Lgt possesses two distinct binding sites: one for the phosphatidylglycerol substrate and another for the preprolipoprotein. The enzyme contains multiple transmembrane segments that anchor it within the cytoplasmic membrane. Crystallographic studies have identified critical residues, including Arg143 and Arg239, that are essential for diacylglyceryl transfer activity. The structural data supports a mechanism whereby substrate and product (lipid-modified lipobox-containing peptide) enter and exit the enzyme laterally relative to the lipid bilayer. This lateral access model is consistent with Lgt's function of modifying proteins as they emerge from the Sec or Tat translocon within the membrane environment .

What is the catalytic mechanism of Lgt in E. coli?

The catalytic mechanism of Lgt involves the transfer of a diacylglyceryl moiety from phosphatidylglycerol to the sulfhydryl group of the conserved cysteine residue in the lipobox of preprolipoproteins, forming a thioether bond. The reaction proceeds through the following steps:

  • Binding of phosphatidylglycerol within the substrate binding pocket of Lgt

  • Recognition and binding of the preprolipoprotein substrate containing the conserved lipobox motif

  • Nucleophilic attack by the sulfhydryl group of the conserved cysteine (Cys+1) on the ester bond of phosphatidylglycerol

  • Formation of the thioether linkage between the diacylglyceryl moiety and cysteine

  • Release of glycerol phosphate as a byproduct

  • Lateral release of the modified prolipoprotein from the enzyme

Key residues including Arg143 and Arg239 are essential for this process, as demonstrated by complementation studies with mutant Lgt variants. The enzyme specifically recognizes the lipobox motif, which typically consists of a sequence [LVI][ASTVI][GAS]C, where C is the invariant cysteine that becomes modified .

How does the substrate specificity of Lgt differ between E. coli strains?

The substrate specificity likely focuses primarily on the recognition of the lipobox motif rather than strain-specific preprolipoprotein differences. In laboratory investigations, peptide substrates derived from common lipoproteins such as Pal (containing the sequence IAAC, where C is the conserved cysteine modified by Lgt) have been used successfully to measure Lgt activity across different E. coli strains. When comparing enzyme functionality between strains, studies have shown that complementation with Lgt from one strain can rescue growth defects in another strain, suggesting conserved substrate recognition mechanisms .

What are the methods for measuring Lgt enzymatic activity in vitro?

Lgt enzymatic activity can be measured in vitro through several approaches:

  • Glycerol phosphate release assay: This method measures the release of glycerol phosphate (G1P or G3P), which is a byproduct of the Lgt-catalyzed transfer of diacylglyceryl from phosphatidylglycerol to a peptide substrate. The detection typically employs a coupled luciferase reaction system that generates a luminescent signal proportional to the amount of glycerol phosphate released. Using a phosphatidylglycerol substrate with a racemic glycerol moiety results in the release of both G1P and G3P during the reaction.

  • Radiolabeled substrate assay: Using radiolabeled phosphatidylglycerol (typically ³H or ¹⁴C-labeled) and monitoring the transfer of the labeled diacylglyceryl moiety to the peptide substrate.

  • Fluorescence-based assays: A GFP-based in vitro assay can be employed to correlate the activities of Lgt with structural observations, allowing for real-time monitoring of enzyme activity.

  • Mass spectrometry: To directly detect the modification of peptide substrates by measuring the mass increase corresponding to the addition of the diacylglyceryl moiety.

For inhibition studies, IC₅₀ values can be determined by measuring enzyme activity in the presence of varying concentrations of potential inhibitors. Control experiments typically include using a mutant peptide substrate with the conserved cysteine mutated to alanine (e.g., Pal-IAA), which cannot be modified by Lgt and thus serves as a negative control .

How can researchers create conditional Lgt depletion strains in E. coli?

Creating conditional Lgt depletion strains in E. coli is a valuable approach for studying this essential enzyme. The methodology involves:

  • Chromosomal replacement of the native promoter: Replace the native lgt promoter with an inducible promoter system, such as the arabinose-inducible araBAD promoter (P<sub>BAD</sub>).

  • Construction of the depletion strain: This can be accomplished through lambda Red recombineering, where a cassette containing the inducible promoter and a selection marker is integrated at the lgt locus.

  • Verification of conditional expression: Confirm that Lgt expression is dependent on the inducer (e.g., arabinose) by Western blotting under inducing and non-inducing conditions.

  • Growth conditions for depletion studies:

    • Grow the strain in the presence of inducer to maintain Lgt expression

    • Wash cells and transfer to media without inducer to initiate Lgt depletion

    • Monitor growth, morphology, and viability over time

  • Complementation controls: Include plasmid-based complementation with wild-type lgt to verify that observed phenotypes are specifically due to Lgt depletion rather than polar effects on downstream genes like thyA.

When constructing such strains, it's important to verify that expression of downstream genes (e.g., thyA, which encodes thymidylate synthase and often has a ribosome binding site that overlaps with the lgt stop codon) is not affected by the manipulation of lgt expression .

What techniques are used to detect lipoprotein modification by Lgt in E. coli?

Several techniques can be employed to detect lipoprotein modification by Lgt in E. coli:

  • Gel shift assays: SDS-PAGE analysis can distinguish between modified and unmodified forms of lipoproteins, as lipidated proteins often show altered mobility. For example, the major outer membrane lipoprotein Lpp appears as distinct bands representing different forms: UPLP (unlipidated prolipoprotein), DGPLP (diacylglyceryl-modified prolipoprotein), and mature Lpp.

  • Membrane fractionation: Separation of membrane fractions can be used to assess the localization of lipoproteins. Properly modified lipoproteins associate with membrane fractions, while unlipidated forms may be found in soluble fractions.

  • Peptidoglycan association assays: For lipoproteins that bind to peptidoglycan (PG), such as Lpp, PG-association can be measured by isolating the PG fraction and detecting the presence of the lipoprotein. Lgt depletion leads to decreased PG-associated DGPLP and other PG-linked Lpp forms.

  • Western blotting: Using antibodies specific to the lipoprotein of interest to detect different forms of the protein in various cellular fractions.

  • Mass spectrometry: Liquid chromatography-mass spectrometry (LC-MS) can directly detect the mass difference between unlipidated and lipidated forms of lipoproteins, providing definitive evidence of modification.

  • Metabolic labeling: Incorporation of radioactive or clickable lipid precursors can be used to specifically label lipidated proteins, which can then be detected by autoradiography or click chemistry-based detection methods .

What makes Lgt a promising antibacterial target compared to other lipoprotein processing enzymes?

Lgt demonstrates several distinct advantages as an antibacterial target compared to other lipoprotein processing enzymes:

  • Resistance mechanisms: Unlike inhibitors of downstream lipoprotein processing enzymes such as LspA (lipoprotein signal peptidase) and LolCDE (lipoprotein transport complex), resistance to Lgt inhibition through deletion of the major outer membrane lipoprotein gene (lpp) does not occur. In fact, deletion of lpp actually increases sensitivity to Lgt depletion, suggesting that resistance through this common mechanism is unlikely to develop.

  • Essential function: Lgt is essential in most Gram-negative bacteria, including clinically relevant pathogens such as E. coli and Acinetobacter baumannii, making it a broadly applicable target.

  • First irreversible step: Lgt catalyzes the first irreversible step in lipoprotein maturation, providing a strategic intervention point in the pathway.

  • Permeabilization effects: Inhibition of Lgt leads to outer membrane permeabilization and increased sensitivity to serum killing and antibiotics, potentially enabling combination therapy approaches.

  • Structural insights: The availability of high-resolution crystal structures (1.6-1.9 Å) of E. coli Lgt provides valuable information for structure-based drug design.

  • No human homolog: The absence of a human homolog reduces the risk of off-target effects, improving the safety profile of potential inhibitors .

How have researchers identified and validated inhibitors of E. coli Lgt?

Researchers have employed a multi-faceted approach to identify and validate inhibitors of E. coli Lgt:

  • Initial screening: Lgt inhibitors were identified using a binding screen to identify molecules that interact with the enzyme.

  • Biochemical validation: Candidate inhibitors were tested in an in vitro enzymatic assay measuring glycerol phosphate release from phosphatidylglycerol during the Lgt-catalyzed reaction. Potent inhibitors like G9066, G2823, and G2824 demonstrated IC₅₀ values in the submicromolar range (0.18-0.93 μM).

  • Phenotypic confirmation: Treatment of E. coli with Lgt inhibitors recapitulated the phenotypes observed in genetic Lgt depletion studies, including growth inhibition and membrane permeabilization.

  • Specificity testing: Inhibitors were confirmed to specifically target Lgt by comparing their effects to those observed in Lgt depletion strains and by testing their impact on lipidation of model lipoproteins.

  • Resistance studies: Attempts to generate resistant mutants against Lgt inhibitors were unsuccessful, supporting the hypothesis that mutations disrupting inhibitor binding might result in loss of essential Lgt function.

  • Mechanistic studies: Biochemical analyses were performed to determine if inhibitors competitively inhibit binding of the phosphatidylglycerol or prolipoprotein substrates.

  • Cross-species activity: Lgt inhibitors were tested against multiple bacterial species, demonstrating bactericidal activity against both E. coli and A. baumannii .

CompoundIC₅₀ against E. coli LgtBactericidal activity
G90660.24 μMActive against E. coli and A. baumannii
G28230.93 μMActive against E. coli and A. baumannii
G28240.18 μMActive against E. coli and A. baumannii

What cellular effects result from Lgt inhibition in E. coli?

Lgt inhibition in E. coli produces several significant cellular effects:

  • Growth inhibition: Treatment with Lgt inhibitors or depletion of Lgt leads to severe growth defects and eventual cell death.

  • Outer membrane permeabilization: Inhibition of Lgt results in compromised outer membrane integrity, allowing increased penetration of hydrophobic compounds.

  • Increased antibiotic sensitivity: Bacteria with reduced Lgt activity show enhanced susceptibility to antibiotics, particularly those normally excluded by the outer membrane permeability barrier.

  • Serum sensitivity: Lgt-depleted cells demonstrate increased sensitivity to killing by serum components, indicating compromised defense against host immune factors.

  • Morphological changes: Bacterial cells show abnormal morphology when Lgt is inhibited, reflecting disruptions in cell envelope architecture.

  • Decreased peptidoglycan association of lipoproteins: Lipoproteins such as Lpp and Pal show reduced association with peptidoglycan when Lgt is inhibited, compromising cell envelope integrity.

  • Accumulation of unlipidated prolipoproteins: Inhibition leads to accumulation of unlipidated forms of lipoproteins (UPLP) that cannot be properly anchored to membranes.

These effects collectively contribute to the bactericidal activity of Lgt inhibitors and highlight the critical role of lipoproteins in maintaining cell envelope integrity in Gram-negative bacteria .

How does the structure-function relationship of E. coli Lgt inform inhibitor design?

The high-resolution crystal structures of E. coli Lgt (1.6-1.9 Å) provide critical insights that can guide rational inhibitor design:

  • Binding site architecture: Crystal structures reveal two distinct binding sites within Lgt - one for phosphatidylglycerol and another for the preprolipoprotein substrate. Inhibitors can be designed to target either site or the interface between them to disrupt the enzymatic reaction.

  • Critical residues: Complementation studies with mutant Lgt variants have identified residues essential for catalytic activity, including Arg143 and Arg239. These residues represent priority targets for structure-based inhibitor design, as molecules that interact with these residues are likely to disrupt enzyme function.

  • Substrate entry/exit pathways: The structural data support a mechanism whereby substrates and products enter and exit the enzyme laterally relative to the lipid bilayer. Inhibitors could be designed to block these lateral access channels, preventing substrate binding or product release.

  • Conserved motifs: Identification of conserved structural motifs across Lgt enzymes from different bacterial species can inform the design of broad-spectrum inhibitors.

  • Binding mode of known inhibitors: The co-crystal structure with palmitic acid provides a template for understanding how inhibitors interact with the enzyme. This information can be used to optimize lead compounds for improved potency and specificity.

  • Rational modifications: Understanding the structural basis for inhibitor binding allows for rational modification of lead compounds to improve pharmacokinetic properties while maintaining target engagement .

What role does Lgt play in the virulence of pathogenic E. coli strains such as O45:K1?

While the search results don't specifically address the O45:K1 strain, we can infer the role of Lgt in pathogenic E. coli virulence based on studies of other pathogenic strains:

  • Outer membrane integrity: Lgt is crucial for maintaining outer membrane integrity, which is a key determinant of bacterial survival within host environments. In uropathogenic E. coli, Lgt depletion leads to increased sensitivity to serum killing, suggesting its importance in evading host immune defenses.

  • Virulence factor expression: Many virulence factors in pathogenic E. coli are lipoproteins or depend on lipoproteins for their proper localization and function. Proper processing of these factors by Lgt is likely essential for their contribution to pathogenesis.

  • Immune evasion: Correctly processed lipoproteins in the outer membrane help pathogenic strains resist host defense mechanisms, including complement-mediated killing and antimicrobial peptides.

  • Adhesion and colonization: Some adhesins and proteins involved in biofilm formation are lipoproteins that require Lgt for proper modification. These factors are critical for colonization of host tissues.

  • Stress response: Lipoproteins play important roles in bacterial stress responses, including adaptation to the challenging environments encountered during infection.

  • Nutrient acquisition: Many nutrient uptake systems in pathogenic E. coli involve lipoproteins, which are essential for bacterial survival in nutrient-limited host environments.

For O45:K1 specifically, which is associated with neonatal meningitis and possesses a protective K1 capsule, lipoproteins likely play additional roles in capsule assembly and maintenance, blood-brain barrier penetration, and survival in cerebrospinal fluid .

How do the kinetics of Lgt-catalyzed reactions differ between in vitro reconstituted systems and in vivo cellular environments?

The kinetics of Lgt-catalyzed reactions can differ significantly between in vitro reconstituted systems and in vivo cellular environments due to several factors:

  • Substrate presentation: In vivo, preprolipoproteins emerge directly from the Sec or Tat translocon and are immediately accessible to Lgt, creating a coupled process of translocation and modification. In vitro systems typically use purified or synthetic peptide substrates that may not fully recapitulate the natural substrate presentation.

  • Membrane environment: The native lipid composition and physical properties of the bacterial inner membrane influence Lgt activity. In vitro reconstituted systems may use simplified lipid mixtures that lack the complexity of the natural membrane environment.

  • Substrate concentration: The local concentration of substrates in the cellular membrane likely differs from that in reconstituted systems, affecting reaction kinetics. The bacterial cell can regulate the expression and delivery of preprolipoproteins to Lgt in ways that are difficult to mimic in vitro.

  • Coupled processes: In vivo, lipoprotein processing involves a series of enzymes (Lgt, LspA, and in some cases Lnt) that may operate in a coordinated manner. This coupling may influence the kinetics of each individual step, including the Lgt-catalyzed reaction.

  • Competitive substrates: In the cellular environment, Lgt must recognize and modify numerous different preprolipoproteins, potentially leading to substrate competition effects that are not captured in simplified in vitro assays using single peptide substrates.

  • Phosphatidylglycerol availability: The availability of the lipid substrate phosphatidylglycerol in the membrane may be regulated in vivo in ways that affect Lgt kinetics.

In vitro studies using purified components are valuable for determining basic enzymatic parameters and inhibitor binding, but may not fully predict the complexity of in vivo behavior. Researchers must consider these differences when extrapolating in vitro findings to cellular contexts .

What expression systems are optimal for producing recombinant E. coli Lgt for structural and functional studies?

Producing recombinant E. coli Lgt for structural and functional studies requires careful consideration of expression systems:

  • Homologous expression: Expression in E. coli hosts is often preferred for structural studies of E. coli Lgt, as this ensures proper folding and insertion into membranes. Specialized E. coli strains such as C41(DE3) or C43(DE3), designed for membrane protein expression, can improve yields.

  • Expression constructs: Fusion tags can facilitate purification while minimizing interference with Lgt function. Common approaches include:

    • C-terminal His₆ or His₁₀ tags for affinity purification

    • Removal of N-terminal tags to avoid interference with membrane insertion

    • Use of cleavable tags (TEV or PreScission protease sites) to obtain native protein after purification

  • Induction conditions: Careful optimization of induction parameters is essential:

    • Lower temperatures (16-25°C) during induction to minimize aggregation

    • Reduced inducer concentrations to prevent overwhelming the membrane insertion machinery

    • Extended expression periods to maximize yield of properly folded protein

  • Membrane extraction: Efficient extraction from membranes requires:

    • Selection of appropriate detergents (DDM, LDAO, or other mild detergents)

    • Optimization of detergent:protein ratios to maintain enzyme activity

    • Inclusion of phospholipids during purification to stabilize the protein

  • Functional verification: Confirmation of enzymatic activity after purification using in vitro assays measuring diacylglyceryl transfer to peptide substrates.

For crystallographic studies specifically, additional considerations include the production of highly pure, homogeneous, and stable protein preparations suitable for crystallization trials. The successful crystallization of E. coli Lgt at high resolution (1.6-1.9 Å) demonstrates that these technical challenges can be overcome with careful optimization .

How can researchers distinguish between direct and indirect effects of Lgt inhibition in E. coli?

Distinguishing between direct and indirect effects of Lgt inhibition requires a systematic approach:

  • Parallel genetic and chemical inhibition studies: Compare phenotypes observed with chemical inhibitors to those seen in genetic depletion strains. Consistent effects across both approaches suggest direct consequences of Lgt inhibition.

  • Dose-response relationships: Establish dose-response curves for various phenotypes and determine if they correlate with the degree of Lgt inhibition measured biochemically.

  • Time-course analyses: Monitor the temporal progression of different phenotypes after Lgt inhibition. Direct effects typically appear earlier than secondary consequences.

  • Biochemical verification: Directly measure the impact on Lgt enzymatic activity by assessing lipoprotein modification status:

    • Analysis of lipidation states of model lipoproteins like Lpp and Pal

    • Quantification of unprocessed preprolipoprotein accumulation

    • Assessment of peptidoglycan association of lipoproteins

  • Complementation studies: Test if phenotypes can be rescued by expression of wild-type Lgt but not catalytically inactive mutants.

  • Controls for off-target effects: Include controls specifically designed to detect potential off-target activities:

    • Testing inhibitors against Lgt variants with altered binding sites

    • Assessing activity against unrelated enzymes to confirm specificity

    • Evaluating effects in organisms naturally lacking Lgt (if available)

  • Isolation of resistant mutants: Attempts to isolate resistant mutants can provide insights into the mechanism of action and potential off-target activities.

By integrating these approaches, researchers can build a compelling case for attributing observed phenotypes directly to Lgt inhibition rather than secondary effects or off-target activities .

What are the key considerations for developing assays to screen for Lgt inhibitors in high-throughput formats?

Developing high-throughput screening (HTS) assays for Lgt inhibitors requires addressing several technical challenges:

  • Assay format selection:

    • Biochemical assays measuring glycerol phosphate release can be adapted to microplate formats using coupled enzyme reactions for colorimetric or luminescent readouts

    • Fluorescence-based assays using labeled substrates or products offer high sensitivity

    • Cell-based reporter systems using growth inhibition or fluorescent reporters linked to outer membrane stress can provide functional readouts

  • Substrate considerations:

    • For biochemical assays, optimize peptide substrate design based on known Lgt substrates (e.g., Pal-derived peptides containing the lipobox motif)

    • Ensure phosphatidylglycerol preparations are consistent in quality and composition

    • Consider using substrate analogs with improved stability or detection properties

  • Assay optimization parameters:

    • Signal-to-background ratio: Aim for >3-fold signal window

    • Z-factor: Optimize conditions to achieve Z' ≥ 0.5 for statistical reliability

    • DMSO tolerance: Ensure assay performs consistently at DMSO concentrations needed for compound solubilization (typically 0.1-1%)

    • Enzyme concentration: Use the minimum concentration needed for reliable signal detection

  • Counter-screens and secondary assays:

    • Develop orthogonal assays to confirm hits and eliminate false positives

    • Include counter-screens to identify compounds that interfere with detection systems

    • Design secondary assays to confirm on-target activity in cellular contexts

  • Membrane protein considerations:

    • Ensure consistent preparation and stability of Lgt enzyme preparations

    • Consider the membrane environment for optimal enzyme activity

    • Evaluate the need for detergents or lipid bilayer mimetics and their compatibility with screening formats

  • Automation compatibility:

    • Design assays with minimal liquid handling steps

    • Ensure compatibility with automated dispensing and detection equipment

    • Develop protocols with appropriate incubation times for batch processing

A successful HTS campaign for Lgt inhibitors would likely employ a primary biochemical screen followed by secondary assays to confirm on-target activity and assess antibacterial potential .

How does E. coli Lgt differ from its counterparts in other bacterial species?

E. coli Lgt shares the core catalytic function with its counterparts across bacterial species but exhibits important differences:

These differences have important implications for both basic research and drug development efforts targeting Lgt across diverse bacterial pathogens .

What evolutionary patterns are observed in Lgt across bacterial phyla?

Evolutionary analysis of Lgt across bacterial phyla reveals several significant patterns:

This evolutionary perspective provides valuable context for understanding the significance of Lgt in different bacterial species and can inform strategies for developing antimicrobials targeting this enzyme .

How does O45:K1 serotype influence the function or expression of Lgt in E. coli?

While the search results don't specifically address the O45:K1 serotype's influence on Lgt, we can make informed inferences based on what is known about serotype-specific bacterial physiology:

  • O-antigen interactions: The O45 antigen, part of the lipopolysaccharide (LPS) layer, creates a specific outer membrane environment that may influence Lgt function. The physical properties of this environment could affect enzyme activity, substrate accessibility, or the proper insertion and orientation of Lgt in the inner membrane.

  • K1 capsule effects: The K1 capsule, composed of polysialic acid, creates a hydrophilic layer around the bacterium that could affect membrane properties and potentially influence the microenvironment in which Lgt operates. The capsule may also alter the exposure of certain lipoproteins to the external environment.

  • Strain-specific lipoprotein repertoire: O45:K1 strains, associated with extraintestinal infections including neonatal meningitis, likely possess a specialized repertoire of lipoproteins involved in virulence and host adaptation. This could place unique demands on Lgt in terms of substrate processing.

  • Regulation in response to host environments: O45:K1 strains encounter specific host environments, including the blood-brain barrier, which may trigger serotype-specific regulatory responses affecting Lgt expression or activity.

  • Interactions with other virulence factors: The O45:K1 serotype expresses specific virulence factors that may interact functionally with properly processed lipoproteins, creating selection pressure for optimal Lgt function in this pathotype.

Further research specifically addressing the relationship between the O45:K1 serotype and Lgt function would be valuable for understanding the role of this enzyme in this clinically important pathogenic E. coli lineage .

What are the most promising approaches for developing new Lgt inhibitors with clinical potential?

Several approaches show promise for developing clinically viable Lgt inhibitors:

  • Structure-based drug design: The availability of high-resolution crystal structures of E. coli Lgt (1.6-1.9 Å) provides an excellent foundation for rational design of inhibitors targeting key binding sites or catalytic residues.

  • Fragment-based screening: Starting with small molecular fragments that bind to specific pockets within Lgt and then growing or linking these fragments to develop high-affinity inhibitors.

  • Natural product exploration: Screening natural product libraries may reveal novel scaffolds with activity against Lgt, as natural products often possess unique chemical properties suited for targeting membrane proteins.

  • Peptide mimetics: Developing non-hydrolyzable analogs of the lipobox-containing peptide substrate that can compete for binding to Lgt without being processed.

  • Allosteric inhibitors: Identifying compounds that bind to sites distinct from the active site but alter enzyme conformation to inhibit activity.

  • Phosphatidylglycerol analogs: Creating non-hydrolyzable analogs of the phosphatidylglycerol substrate that competitively inhibit Lgt activity.

  • Combination approaches: Developing Lgt inhibitors that synergize with existing antibiotics, leveraging the membrane permeabilization effects of Lgt inhibition.

  • Prodrug strategies: Designing prodrugs that are activated specifically in bacterial environments to improve selectivity and reduce off-target effects.

These approaches should focus on developing inhibitors with:

  • Broad-spectrum activity against clinically relevant Gram-negative pathogens

  • Limited potential for resistance development

  • Favorable pharmacokinetic and safety profiles

  • Chemical stability and formulation characteristics suitable for clinical use .

What techniques could improve structural understanding of Lgt-substrate interactions?

Advanced techniques that could enhance our understanding of Lgt-substrate interactions include:

  • Cryo-electron microscopy (cryo-EM): This technique could capture different conformational states of Lgt during the catalytic cycle, potentially revealing transient interactions with substrates that are difficult to capture in crystal structures.

  • Molecular dynamics simulations: Computational approaches can model the dynamic interactions between Lgt, membrane lipids, and both lipid and peptide substrates, providing insights into the catalytic mechanism and substrate recognition.

  • Time-resolved crystallography: Using methods such as time-resolved X-ray crystallography or serial femtosecond crystallography at X-ray free-electron lasers (XFELs) to capture snapshots of the enzyme during catalysis.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This technique can identify regions of Lgt that undergo conformational changes upon substrate binding or during catalysis.

  • Single-molecule FRET studies: Fluorescence resonance energy transfer experiments could track the movement of substrates and conformational changes in real-time during the catalytic cycle.

  • NMR spectroscopy: Solution or solid-state NMR could provide additional structural information, particularly regarding flexible regions that may be difficult to resolve by crystallography.

  • Cross-linking mass spectrometry: Chemical cross-linking combined with mass spectrometry could identify specific contact points between Lgt and its substrates.

  • Native mass spectrometry: This approach could capture intact Lgt-substrate complexes, providing insights into the stoichiometry and stability of these interactions.

  • Lipid nanodiscs: Reconstituting Lgt in lipid nanodiscs could provide a more native-like membrane environment for structural and functional studies compared to detergent-solubilized protein.

These techniques, particularly when used in combination, could provide a comprehensive understanding of how Lgt recognizes and processes its substrates, informing both basic science and drug discovery efforts .

How might the study of Lgt contribute to our understanding of bacterial membrane biogenesis and antibiotic resistance?

Research on Lgt has significant implications for understanding broader aspects of bacterial physiology:

  • Membrane homeostasis: Studies of Lgt provide insights into how bacteria maintain outer membrane integrity through proper lipoprotein processing and localization. This knowledge enhances our understanding of fundamental principles of bacterial membrane biogenesis and homeostasis.

  • Antibiotic permeability barriers: Lgt inhibition leads to outer membrane permeabilization, highlighting the role of lipoproteins in maintaining the permeability barrier that excludes many antibiotics. This knowledge could inform strategies to enhance antibiotic penetration into Gram-negative bacteria.

  • Novel resistance mechanisms: Understanding how bacteria might develop resistance to Lgt inhibitors could reveal previously unrecognized mechanisms of adaptation to membrane stress, potentially applicable to other antimicrobial agents.

  • Bacterial stress responses: The cellular response to Lgt inhibition reveals how bacteria sense and respond to disruptions in lipoprotein processing, providing insights into stress response networks.

  • Envelope quality control systems: Research on Lgt can elucidate how bacteria monitor and maintain envelope integrity, including quality control mechanisms for detecting and responding to improperly processed lipoproteins.

  • Evolutionary adaptability: Comparing the essentiality and function of Lgt across bacterial species reveals evolutionary strategies for adapting cell envelope architecture to different ecological niches.

  • Host-pathogen interactions: Understanding how properly processed lipoproteins contribute to bacterial virulence and immune evasion provides insights into host-pathogen dynamics.

  • Synergistic antibiotic approaches: Knowledge of how Lgt inhibition sensitizes bacteria to other antibiotics could inform rational combination therapy approaches to overcome existing resistance mechanisms.

By continuing to unravel the complex role of Lgt in bacterial physiology, researchers can gain fundamental insights into bacterial cell biology while simultaneously advancing the development of novel therapeutic strategies to combat antibiotic-resistant infections .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.