Recombinant Escherichia coli O45:K1 Rhomboid protease glpG (glpG)

Shipped with Ice Packs
In Stock

Description

Catalytic Mechanism

  • Cleaves substrates at hydrophilic regions near transmembrane domains, favoring sequences with helix-destabilizing residues (e.g., glycine, proline) .

  • Exhibits pH-dependent activity, with optimal function in Tris-based buffers (pH 8.0) .

  • Covalently inhibited by phosphonofluoridate compounds, confirming its serine protease activity .

Substrate Specificity

  • Preferentially processes orphan membrane proteins (e.g., components of respiratory complexes) that lack stabilizing interactions with partner subunits .

  • Recognizes substrates via transmembrane domain features rather than specific sequence motifs .

In Vitro Studies

  • Model substrate cleavage: Used to study proteolytic kinetics with fusion proteins like Bla-LY2-MBP .

  • Crystallography: Facilitated structural studies of inhibitor-bound GlpG, revealing conformational changes during catalysis .

Biological Relevance

  • Gut colonization: GlpG promotes persistence of extraintestinal pathogenic E. coli (ExPEC) in the mammalian gut by supporting fatty acid metabolism .

  • Quality control: Degrades misfolded membrane proteins, preventing cytotoxic accumulation .

Production and Purification

Recombinant GlpG is typically expressed in E. coli expression systems and purified via affinity chromatography .

ParameterSpecification
Expression HostE. coli
TagHis-tag (N-terminal)
Purity≥85% (SDS-PAGE)
Storage-20°C in Tris buffer with 50% glycerol; avoid freeze-thaw cycles
Reconstitution0.1–1.0 mg/mL in deionized water with 50% glycerol for stability

Key Research Findings

  1. Role in Bacterial Fitness
    Deletion of glpG in E. coli reduces growth in intestinal mucus and oleate media by disrupting glycerophospholipid metabolism .

    • ΔglpG mutants show >120-fold reduction in gut colonization in mice .

  2. Enzymatic Regulation
    GlpG’s active site is accessible to the periplasm, enabling cleavage of substrates near the membrane-water interface .

  3. Therapeutic Implications
    Targeting GlpG could mitigate infections caused by ExPEC strains, though no inhibitors are clinically approved yet .

Comparative Analysis with Other Rhomboids

FeatureGlpG (E. coli O45:K1)AarA (Providencia stuartii)
Substrate PreferenceOrphan respiratory proteins TatA component of twin-arginine translocase
Transmembrane Domains6 TMDs 7 TMDs
Catalytic ResiduesSer/His dyad Ser/His dyad

Future Directions

  • Structural dynamics: High-resolution studies of substrate-bound GlpG to elucidate cleavage mechanisms .

  • Pathogen targeting: Development of GlpG-specific inhibitors to combat antibiotic-resistant ExPEC infections .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
glpG; ECS88_3813; Rhomboid protease GlpG; Intramembrane serine protease
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-276
Protein Length
full length protein
Species
Escherichia coli O45:K1 (strain S88 / ExPEC)
Target Names
glpG
Target Protein Sequence
MLMITSFANPRVAQAFVDYMATQGVILTIQQHNQSDVWLADESQAERVRAELARFLENPA DPRYLAASWQAGHTGSGLHYRRYPFFAALRERAGPVTWVMMIACVVVFIAMQILGDQEVM LWLAWPFDPTLKFEFWRYFTHALMHFSLMHILFNLLWWWYLGGAVEKRLGSGKLIVITLI SALLSGYVQQKFSGPWFGGLSGVVYALMGYVWLRGERDPQSGIYLQRGLIIFALIWIVAG WFDLFGMSMANGAHIAGLAVGLAMAFVDSLNARKRK
Uniprot No.

Target Background

Function

Function: Rhomboid-type serine protease that catalyzes intramembrane proteolysis.

Database Links
Protein Families
Peptidase S54 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and membrane topology of GlpG protease?

GlpG is a membrane-embedded protease belonging to the widely conserved rhomboid family of membrane proteases in Escherichia coli. The protein has a verified topology that traverses the bacterial membrane six times, creating a complex integral membrane structure . The full-length protein consists of 276 amino acids with a molecular sequence that includes critical catalytic residues positioned strategically within the transmembrane domains . Structural studies have revealed that GlpG contains conserved Ser and His residues that are essential for its proteolytic activities, conforming to the characteristic catalytic mechanism of serine proteases . The protein adopts a folded conformation within the lipid bilayer that enables it to recognize and cleave specific transmembrane substrates, highlighting its specialized function in membrane protein processing .

What are the key functional domains and essential amino acid residues in GlpG?

The functional architecture of GlpG includes several critical domains that contribute to its proteolytic activity and substrate specificity. The conserved Ser and His residues form the catalytic dyad that is essential for the proteolytic mechanism, as demonstrated by site-directed mutagenesis studies . The amino acid sequence of GlpG (MLMITSFANPRVAQAFVDYMATQGVILTIQQHNQSDVWLADESQAERVRAELARFLENPADPRYLAASWQAGHTGSGLHYRRYPFFAALRERAGPVTWVMMIACVVVFIAMQILGDQEVMLWLAWPFDPTLKFEFWRYFTHALMHFSLMHILFNLLWWWYLGGAVEKRLGSGKLIVITLISALLSGYVQQKFSGPWFGGLSGVVYALMGYVWLRGERDPQSGIYLQRGLIIFALIWIVAGWFDLFGMSMANGAHIAGLAVGLAMAFVDSLNARKRK) reveals transmembrane regions that are critical for its integration into the membrane and for substrate recognition . The protein contains specific hydrophobic segments that anchor it in the membrane, interspersed with hydrophilic loops that may play roles in substrate binding and catalysis. Experimental evidence indicates that GlpG recognizes features of the transmembrane regions of its substrates, suggesting specialized protein-protein interaction domains within its structure .

How does GlpG compare to other rhomboid proteases in terms of sequence conservation?

GlpG belongs to the rhomboid family of membrane proteases, which is widely conserved across diverse organisms from bacteria to humans. Sequence analysis reveals that E. coli GlpG shares significant homology with other rhomboid proteases, particularly in the catalytic regions containing the essential Ser and His residues . The six transmembrane topology is a defining characteristic shared among rhomboid family members, though specific structural adaptations exist between bacterial and eukaryotic homologs. Comparative genomic studies have positioned GlpG as a model system for understanding the broader class of rhomboid proteases, providing insights into evolutionary conservation of this important protease family . While the core catalytic mechanism appears conserved, variations in substrate recognition domains likely reflect the diverse biological roles these proteases play across different species and cellular contexts.

What are the optimal expression and purification methods for recombinant GlpG?

The expression and purification of recombinant GlpG require specialized approaches due to its nature as an integral membrane protein. Based on established protocols, effective expression systems utilize E. coli as the host organism, with the full-length protein (amino acids 1-276) typically fused to an N-terminal His-tag to facilitate purification . The protein expression constructs should include the complete coding sequence while ensuring proper membrane insertion during expression. Purification typically involves detergent solubilization of membrane fractions followed by immobilized metal affinity chromatography (IMAC) utilizing the His-tag . The purified protein is commonly stored in Tris/PBS-based buffer with 6% Trehalose at pH 8.0 to maintain stability, and glycerol (30-50%) is recommended for long-term storage at -20°C/-80°C . To prevent protein degradation and maintain enzymatic activity, it is crucial to avoid repeated freeze-thaw cycles, with working aliquots best stored at 4°C for up to one week .

How can researchers verify the proteolytic activity of purified GlpG in vitro?

Verification of GlpG proteolytic activity can be accomplished through several complementary approaches using carefully designed assays. A validated method involves using model substrate proteins, such as those containing an N-terminal periplasmically localized beta-lactamase (Bla) domain, a transmembrane region, and a cytosolic protein domain . The proteolytic reaction can be monitored by incubating purified GlpG with the purified substrate protein under controlled conditions and analyzing the cleavage products using SDS-PAGE and Western blotting . Mass spectrometry analysis can precisely identify the cleavage site, which has been shown to occur between Ser and Asp residues in regions of high local hydrophilicity, potentially in juxtamembrane rather than intramembrane positions . Control experiments should include testing catalytically inactive GlpG variants with mutations in the conserved Ser and His residues to confirm the specificity of the observed proteolysis . Kinetic parameters can be determined by varying substrate concentrations and measuring the rate of product formation under standardized conditions.

What methods are effective for studying GlpG substrate specificity and recognition?

Investigation of GlpG substrate specificity requires multifaceted approaches combining biochemical, structural, and computational methods. Researchers have successfully employed model proteins with various transmembrane regions to determine the substrate features recognized by GlpG . Systematic mutagenesis of potential substrate transmembrane domains can identify specific amino acid sequences or structural motifs required for GlpG recognition and cleavage. Co-immunoprecipitation experiments can detect direct interactions between GlpG and potential substrate proteins in their native membrane environment. Advanced approaches include fluorescence resonance energy transfer (FRET)-based assays to monitor real-time substrate binding and processing by GlpG in reconstituted membrane systems. Computational modeling and molecular dynamics simulations can provide additional insights into the structural basis of substrate recognition by predicting protein-protein interaction interfaces and energetically favorable binding conformations . Cross-linking studies combined with mass spectrometry can map the precise contact points between GlpG and its substrates, further refining our understanding of specificity determinants.

How does membrane composition affect GlpG activity and substrate processing?

The lipid environment plays a critical role in modulating GlpG activity as this rhomboid protease functions within the membrane bilayer. Researchers investigating this question should consider reconstituting purified GlpG into liposomes with systematically varied lipid compositions to determine how specific phospholipids, membrane thickness, and fluidity influence proteolytic efficiency. Studies have suggested that the hydrophobic mismatch between transmembrane domains and the lipid bilayer may affect substrate recognition and processing by GlpG, making this an important parameter to examine . The local membrane environment likely influences the conformational dynamics of both GlpG and its substrates, potentially affecting the accessibility of cleavage sites. Experimental approaches could include activity assays in native membranes versus detergent-solubilized conditions, or in reconstituted systems with defined lipid compositions, measuring kinetic parameters under each condition. Advanced biophysical techniques such as solid-state NMR spectroscopy or hydrogen-deuterium exchange mass spectrometry could provide insights into how lipid interactions modulate the structural dynamics of GlpG in its active conformation.

What is the molecular mechanism of GlpG-mediated proteolysis within the membrane?

The catalytic mechanism of GlpG involves several specialized steps that enable proteolysis within the hydrophobic membrane environment. As a serine protease, GlpG utilizes a catalytic dyad consisting of conserved Ser and His residues that are essential for proteolytic activity . The reaction likely proceeds through the formation of a tetrahedral intermediate after nucleophilic attack by the catalytic serine on the substrate peptide bond, followed by release of the cleaved products. Structural studies suggest that substrate access to the active site may involve a lateral gate mechanism within the membrane, allowing transmembrane segments to enter the catalytic pocket. This process may require conformational changes in both the enzyme and substrate. Mechanistic insights can be gained through a combination of site-directed mutagenesis of catalytic and substrate-binding residues, transition-state analog inhibitors, and time-resolved structural methods . Molecular dynamics simulations can complement experimental approaches by modeling the energetics and dynamics of substrate entry, catalysis, and product release within the membrane environment.

How do post-translational modifications affect GlpG activity and regulation?

Though less extensively studied than its structural properties, potential post-translational modifications (PTMs) of GlpG may represent an important regulatory mechanism for this membrane protease. Researchers should investigate whether GlpG undergoes phosphorylation, acetylation, or other modifications that could modulate its activity or localization within the bacterial membrane. Mass spectrometry-based proteomics approaches can identify potential modification sites on purified GlpG under different growth or stress conditions. Site-directed mutagenesis of identified or predicted modification sites to either prevent modification (e.g., serine to alanine for phosphorylation sites) or mimic constitutive modification (e.g., serine to aspartate) can test the functional consequences of these PTMs on protease activity. Additional studies could explore how environmental signals or metabolic states influence the PTM status of GlpG, potentially connecting its proteolytic function to cellular stress responses or adaptation mechanisms. The integration of proteomics, biochemical assays, and in vivo phenotypic analyses would provide comprehensive insights into this potential regulatory layer of GlpG function.

How does GlpG contribute to ExPEC survival in the intestinal environment?

GlpG plays a significant role in the fitness and survival of Extraintestinal Pathogenic E. coli (ExPEC) within the intestinal tract. Research has demonstrated that disruption of the glpG gene significantly reduces bacterial fitness in the gut, with studies showing more than a 120-fold reduction in mutant bacterial numbers relative to wild-type by day 14 in mouse colonization models . This profound effect on gut persistence appears to be specific to glpG disruption, as mutation of other genes like fadL or fbp that affect growth in mucus broth in vitro did not significantly impact intestinal colonization in vivo . The mechanism likely involves GlpG's connection to glycerol metabolism and fatty acid utilization, which may be particularly important in the nutrient environment of the intestinal mucus layer. The requirement for GlpG persists even in the presence of the intact natural microbiota, highlighting its importance under competitive conditions that mimic the natural gut ecosystem . Understanding this survival advantage provided by GlpG could reveal new targets for preventing ExPEC colonization as a prerequisite to extraintestinal infections.

What is the relationship between GlpG, the glpEGR operon, and metabolism of intestinal nutrients?

The functional relationship between GlpG, the glpEGR operon, and metabolism of intestinal nutrients reveals a complex regulatory network affecting bacterial fitness. GlpG is encoded within the glpEGR operon, where its disruption has polar effects on the downstream gene glpR, which encodes a transcriptional repressor of factors involved in glycerol degradation . Experimental evidence indicates that mutation of either glpG or glpR impairs ExPEC growth in mucus and on plates containing the long-chain fatty acid oleate as the sole carbon source, suggesting a mechanistic link between glycerol metabolism and fatty acid utilization . Significantly, the growth defect of glp mutants on oleate can be rescued by the addition of glycerol-3-phosphate (G3P), indicating that disruption of the glp operon causes depletion of G3P, which in turn affects the ability of ExPEC to utilize long-chain fatty acids like those found in intestinal mucus . This metabolic relationship explains why GlpG is important for growth in intestinal mucus, which serves as a major nutrient source for E. coli in the gut and contains substantial amounts of fatty acids that require proper glycerol metabolism for their utilization .

How might GlpG function be targeted for therapeutic interventions against pathogenic E. coli?

The critical role of GlpG in ExPEC gut colonization and persistence presents a promising target for therapeutic interventions to prevent extraintestinal infections. Potential approaches could include the development of small molecule inhibitors specifically targeting the catalytic activity of GlpG, focusing on compounds that can interact with the conserved Ser and His residues essential for its proteolytic function . Structure-based drug design utilizing available information about GlpG's membrane topology and active site could guide the creation of selective inhibitors that penetrate the bacterial membrane. Alternative strategies might target the regulatory relationship between GlpG and glycerol metabolism, either by modulating GlpR activity or by interfering with glycerol-3-phosphate utilization in the presence of long-chain fatty acids . Given that ExPEC colonization of the intestinal tract is often a prerequisite for extraintestinal pathogenesis, oral delivery of such inhibitors could prevent the establishment of pathogenic strains before they can translocate to extraintestinal sites. Therapeutic development would require careful consideration of specificity to avoid disrupting beneficial microbiota and should include in vivo testing in colonization models with intact microbiota to evaluate efficacy under physiologically relevant conditions .

What are the current knowledge gaps and future research directions for GlpG studies?

Despite significant advances in understanding GlpG structure and function, several important knowledge gaps remain that warrant future investigation. The natural physiological substrates of GlpG in E. coli have not been definitively identified, limiting our understanding of its specific biological roles beyond its connection to metabolism . The precise molecular mechanism by which GlpG activity influences glycerol metabolism and fatty acid utilization requires further elucidation, particularly the signaling pathways connecting proteolytic activity to metabolic regulation . Structural studies have provided insights into GlpG's membrane topology, but higher-resolution information about the dynamic conformational changes during substrate binding and catalysis would enhance our understanding of its mechanism . Additionally, the potential role of GlpG in bacterial stress responses, biofilm formation, or other aspects of bacterial physiology beyond intestinal colonization remains largely unexplored. Future research directions should include comprehensive proteomic approaches to identify natural substrates, detailed metabolomic studies to map the downstream effects of GlpG activity, and investigations into potential applications of GlpG inhibitors as antivirulence compounds against pathogenic E. coli strains .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.